You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: Bcl-XL antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Bcl-XL(120-130aa YQSFEQDTFVE), different from the related rat and mouse sequences by one amino acid.
Catalog Number: 10206-686
Supplier: Boster Biological Technology


Description: MGP Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: E.coli-derived human MGP recombinant protein, Synonyms: Matrix Gla protein, MGP, Cell growth-inhibiting gene 36 protein, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76174-746
Supplier: Boster Biological Technology


Description: SLC12A1 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SLC12A1(125-139aa KVNRPSLLEIHEQLA).
Catalog Number: 10206-664
Supplier: Boster Biological Technology


Description: BMP5 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Conjugate: DyLight* 550, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BMP5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL) Alternative Names: BMP-5, BMP5, Size: 50ug/vial
Catalog Number: 76465-548
Supplier: Boster Biological Technology


Description: EGF Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Mouse, Isotype: IgG, Immunogen: E. Coli-derived mouse EGF recombinant protein, Synonyms: Pro-epidermal growth factor, EGF, Epidermal growth factor, Egf, Application: WB, ELISA, Size: 100ug/vial
Catalog Number: 76174-580
Supplier: Boster Biological Technology


Description: Kv1.1 potassium channel/KCNA1 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: E. Coli-derived human KCNA1 recombinant protein (Position: E7-N477), Alternative Names: Kv1.1, AEMK, EA1, HBK1, HUK1, Applications: ELISA, IF, IHC-P, WB, Size: 100ug/vial
Catalog Number: 76464-632
Supplier: Boster Biological Technology


Description: Desmoglein 3 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Desmoglein 3(981-999aa QLRGSHTMLCTEDPCSRLI ). Application: WB
Catalog Number: 10206-346
Supplier: Boster Biological Technology


Description: Discs Large 1 Polyclonal Antibody, Host: Rabbit, Reactivity: Fruit fly, Size: 200ul/vial
Catalog Number: 76466-146
Supplier: Boster Biological Technology


Description: IL-34 PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species: Human, Assay: 62.5pg/ml, Sandwich High Sensitivity ELISA kit for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-446
Supplier: Boster Biological Technology


Description: Toll-like receptor 1 TLR1 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Rat, Isotype: IgG, Immunogen: E.coli-derived human TLR1 recombinant protein (Position: T62-D404), Alternative Names: TLR1, CD281 antigen, CD281, DKFZp547I0610, DKFZp564I0682, Applications: WB, Size: 100ug/vial
Catalog Number: 76463-700
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Rat trkA, Immunogen: NSO, A33-P418, Assay range: 156pg/ml-10000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, cell lysates and tissue homogenates, 96-well plate precoated
Catalog Number: 10205-868
Supplier: Boster Biological Technology


Description: SUR1 ABCC8 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Conjugate: DyLight* 488, Immunogen: synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQ RSECQLFEHWKTLMNRQDQELEKETVTERKA Alternative Names: SUR1, ABC36, Application: Flow Cytometry, Size: 50ug/vial
Catalog Number: 76463-996
Supplier: Boster Biological Technology


Description: CRLF2/TSLP R ELISA Kit, Sample Volume: 100ul per well, Reactivity: Mouse, Sensitivity: <10pg/ml, Assay Range: 125pg/ml-8000pg/ml, Alternative Names: TSLPR/CRLF2, CRL2, CRL2cytokine receptor CRL2 precusor, CRLF2, CRLF2Y, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-484
Supplier: Boster Biological Technology


Description: Glucose Transporter GLUT4 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Glucose Transporter GLUT4(491-509aa EQEVKPSTELEYLGPDEND).
Catalog Number: 10205-946
Supplier: Boster Biological Technology


Description: DR4 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human DR4 (99-131aa), Synonym: TRAILR1, Application: Flow Cytometry, IHC-F, ICC, WB, Size:100ug
Catalog Number: 76171-574
Supplier: Boster Biological Technology


Description: Collagen I antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Collagen I(1203-1218aa QPPQEKAHDGGRYYRA).
Catalog Number: 10206-430
Supplier: Boster Biological Technology


769 - 784 of 5,847