You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: CNTF Picoband* Polyclonal antibody, Host: Rabbit, Species Reactivity: Mouse, Rat, isotype: IgG, E.coli-derived mouse CNTF recombinant protein (Position: A2-M198). Mouse CNTF shares 83% and 95% amino acid (aa) sequences identity with human and rat CNTF, respectively
Catalog Number: 10209-854
Supplier: Boster Biological Technology


Description: HYAL3 Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Isotype: IgG, A synthetic peptide corresponding to a sequence at the C-terminus of human HYAL3, different from the related rat sequence by three amino acids, and different from the related mouse sequence.
Catalog Number: 10206-934
Supplier: Boster Biological Technology


Description: Epiregulin PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species: Mouse, Assay: 125pg/ml, Sandwich High Sensitivity ELISA kit for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-486
Supplier: Boster Biological Technology


Description: SPARC Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human SPARC recombinant protein (Position: E107-I303, Synonym: SPARC, Basement-membrane protein 40, Application: WB, Size:100ug
Catalog Number: 76171-198
Supplier: Boster Biological Technology


Description: Galectin-1 ELISA Kit EZ-Set* (DIY Antibody Pairs), Sample Volume: 100ul per well, Reactivity: Mouse, Sensitivity: <5pg/ml, Assay Range: 156-10000pg/ml Alternative Name: Galectin-1, 14 kDa laminin-binding protein, Size: For 5 plates, 96 wells each
Catalog Number: 76467-210
Supplier: Boster Biological Technology


Description: Picoband*Musashi 1/Msi1 Polyclonal antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: Sequence at the N-terminus of human Musashi 1/Msi1, Synonyms: RNA-binding protein Musashi homolog 1, Application: IHC-P, WB, Size: 100ug/vial
Catalog Number: 76171-866
Supplier: Boster Biological Technology


Description: Pig Porcine TIMP-3 PicoKine* ELISA Kit, Sensitivity: <2pg/ml, Sample type: cell culture supernates, serum, plasma(heparin, EDTA) and saliva, Species: Pig, Assay: 156pg/ml, Sandwich High Sensitivity, Immunogen: C24-P211, Size: 96wells/kit
Catalog Number: 76172-158
Supplier: Boster Biological Technology


Description: ADH4 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: E. Coli-derived human ADH4 recombinant protein (K218-F380), Synonyms: Alcohol dehydrogenase class II pi chain; ADH4, Application: WB, size: 100ug/vial
Catalog Number: 76172-374
Supplier: Boster Biological Technology


Description: Cathepsin B Picoband* Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, isotype: IgG, E.coli-derived human Cathepsin B recombinant protein (Position: L80-D333), Human Cathepsin B shares 83% and 84% amino acid
Catalog Number: 10209-222
Supplier: Boster Biological Technology


Description: CD86/B7-2 PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates and serum, Species reactivity: Mouse, Assay Range: 62.5pg/ml, Sandwich High Sensitivity ELISA kit for Quantitative Detection, Synonyms: ETC-1, CD86, Size: 96wells/kit
Catalog Number: 76172-200
Supplier: Boster Biological Technology


Description: EphA2 ELISA Kit, Sample Volume: 100ul per well, Reactivity: Human, Sensitivity: <10pg/ml, Assay Range: 15.6pg/ml-1000pg/ml, Immunogen: StandardExpression system : NSO, sequence: A24-V537, Alternative Name: EPHA2, ARCC2, EC 2.7.10, EC 2.7.10.1, Eck, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-612
Supplier: Boster Biological Technology


Description: RanBP2 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human RanBP2 (3018-3057aa), Synonym: RanBP2, p270, RANBP2, NUP358, Application: WB, Size:100ug
Catalog Number: 76171-258
Supplier: Boster Biological Technology


Description: Unrip Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: synthetic peptide corresponding to a the N-terminus (78-104aa), Synonyms: Serine-threonine kinase receptor-associated protein, Application: WB, size: 100ug/vial
Catalog Number: 76173-648
Supplier: Boster Biological Technology


Description: Pax2 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 248-282aa RKHLRADTFTQQQLEALDRVFERPSYPDVFQASEH, Synonyms: Paired box protein Pax-2, PAX2, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76174-284
Supplier: Boster Biological Technology


Description: VASP Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human VASP 78-114aa, Synonym: Vasodilator-stimulated phosphoprotein, VASP, VASP, Application: IHC-P, WB, Size:100ug
Catalog Number: 76170-952
Supplier: Boster Biological Technology


Description: BMP-7 PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: bone tissue, cell culture supernates, serum and plasma((heparin, EDTA), Species reactivity: Rat, Assay: 31.2pg/ml, Sandwich High Sensitivity ELISA kit for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-536
Supplier: Boster Biological Technology


689 - 704 of 5,847