You Searched For: metal trace analysis


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: MMP7 Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: E.coli-derived human MMP7 recombinant protein (Position: M1-K267). Human MMP7 shares 71% amino acid (aa) sequence identity with both mouse and rat MMP7, Application: Western Blot, IHC-P, ELISA
Catalog Number: 10207-070
Supplier: Boster Biological Technology


Description: MIG antibody, Polyclonal, Host: Rabbit, Reactivity: Human, Rabbit IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MIG, Application: IHC-P, WB.
Catalog Number: 10210-014
Supplier: Boster Biological Technology


Description: LASP1 antibody, Polyclonal, Host: Rabbit, Reactivity: HumanRabbit IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human LASP1, Application: IHC-P, WB.
Catalog Number: 10209-968
Supplier: Boster Biological Technology


Description: PF4/Cxcl4 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E. Coli-derived human PF4 recombinant protein (E32-S101), Synonyms: Platelet factor 4; PF-4; C-X-C motif chemokine 4; Iroplact, Application: WB, size: 100ug/vial
Catalog Number: 76172-904
Supplier: Boster Biological Technology


Catalog Number: 10210-084
Supplier: Boster Biological Technology


Description: CD105 Quick ELISA Kit, Reactivity: Human, Sample Type: cell culture supernatants, cell lysates, serum and plasma, Sample Volume: 100ul per well, Sensitivity: <15pg/ml, Assay Range: 156-10,000pg/ml, Alternative Names: Endoglin/CD105, CD105 antigen, Size: 96wells/kit, with removable strips.
Catalog Number: 76467-380
Supplier: Boster Biological Technology


Description: Zinc finger protein GLI2 GLI2 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived GLI2 recombinant protein (Position: K721-D1457), Alternative Names: GLI-2, GLI family zinc finger 2, GLI2, GLI-2, GLI-Kruppel family member GLI2, Size: 100ug/vial
Catalog Number: 76463-898
Supplier: Boster Biological Technology


Description: RENT1/hUPF1 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 578-614aa NMDSMPELQKLQQLKDETGELSSADEKRYRALKRT AE, Synonyms: Regulator of nonsense transcripts 1, UPF1, KIAA0221, RENT1, Size: 100ug/vial
Catalog Number: 76174-540
Supplier: Boster Biological Technology


Description: 5 Lipoxygenase polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human 5 Lipoxygenase(650-667aa AERNKKKQLPYYYLSPDR)
Catalog Number: 10209-170
Supplier: Boster Biological Technology


Description: SHC Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: synthetic peptide corresponding to a sequence at the C-terminus of human SHC (536-564aa), Synonyms: SHC-transforming protein 1, Application: WB, size: 100ug/vial
Catalog Number: 76173-616
Supplier: Boster Biological Technology


Description: FAT10/UBD Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Immunogen: E.coli-derived human FAT10/UBD recombinant protein (Position: M1-I163), Alternative Names: FAT10, Diubiquitin, FAT10, FAT10diubiquitin, GABBR1, Applications: ELISA, WB, Size: 100ug/vial
Catalog Number: 76464-698
Supplier: Boster Biological Technology


Description: Cyclin D1 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse Cyclin D1(219-238aa SPNNFLSCYRTTHFLSRVIK).
Catalog Number: 10206-464
Supplier: Boster Biological Technology


Description: FMO3 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, A synthetic peptide corresponding to a sequence at the N-terminus of human FMO3, different from the related rat sequence by one amino acid, and from the related mouse sequence by two amino acids
Catalog Number: 10207-262
Supplier: Boster Biological Technology


Description: SPR Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Isotype: IgG, Immunogen: E. Coli-derived human SPR recombinant protein (Position: V36-K261), Alternative Names: SPR, EC 1.1.1.153, Gm10328, SDR38C1, Applications: ELISA, WB, Size: 100ug/vial
Catalog Number: 76463-692
Supplier: Boster Biological Technology


Description: CD55 ELISA Kit, Sample Volume: 100ul per well, Reactivity: Mouse, Sensitivity: <50pg/ml, Assay Range: 156pg/ml-10000pg/ml, Alternative Names: CD55/DAF, CD55 antigen, CD55 molecule, decay accelerating factor for complement (Cromer blood group), CD55, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-784
Supplier: Boster Biological Technology


Description: Profilin 2 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Profilin 2(125-140aa NKKAYSMAKYLRDSGF), identical to the related mouse and rat sequences.
Catalog Number: 10206-434
Supplier: Boster Biological Technology


1,745 - 1,760 of 5,847