You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: Tff1 Biotinylated, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Mouse, Concentration Add 0.2ml of distilled water will yield a concentration of 500ug/ml, Synonym: Trefoil factor 1, Protein pS2, Tff1, Bcei, Ps2, Application: ELISA, Size:100ug
Catalog Number: 76171-424
Supplier: Boster Biological Technology


Description: TLS / FUS Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human TLS / FUS (DNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKT), Synonym: FUS, TLS, Application: WB, Size:100ug
Catalog Number: 76171-166
Supplier: Boster Biological Technology


Description: STAT2 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence of STAT2, Alternative Names: STAT2, interferon alpha induced transcriptional activator, ISGF-3, MGC59816, Size: 100ug/vial
Catalog Number: 76464-322
Supplier: Boster Biological Technology


Catalog Number: 10207-584
Supplier: Boster Biological Technology


Description: RAB9 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Rab9, identical to the related rat sequence, and different from the related mouse sequence by one amino acid
Catalog Number: 10207-438
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human TNFSF12, Immunogen: E.coli, S94-H249, Assay range: 62.5pg/ml-4000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-576
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Mouse CCL24/Eotaxin-2, Immunogen: E.coli, V27-V119, Assay range: 15.6pg/ml-1000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-188
Supplier: Boster Biological Technology


Description: DBI Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Immunogen: E. Coli-derived human DBI recombinant protein (Position: S2-I87), Synonym: Acyl-CoA-binding protein, ACBP, Diazepam-binding inhibitor, DBI, Endozepine, EP, DBI, Application: IHC-P, WB, Size:100ug
Catalog Number: 76171-384
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human P-Cadherin, Immunogen: NSO, D108-G654, Assay range: 62.5pg/ml-4000pg/ml, Sensitivity: < 2 pg/ml, Sample type: cell culture supernates and serum, 96-well plate precoated
Catalog Number: 10205-364
Supplier: Boster Biological Technology


Description: NOS1 Antibody monoclonal, Host: Mouse, Species Reactivity: Human, rat, goat, pig, clone: N1, Isotype:IgG, Immunogen: Recombinant neuronal NOS fragment(amino acids 1-181) from rat brain, for Nitric Oxide Synthase, Brain (1-181) NOS1, nitric oxide synthase 1 (neuronal) detection.
Catalog Number: 10205-896
Supplier: Boster Biological Technology


Description: Monkey Primate CXCL14/Brak PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), Species reactivity: Monkey, Assay Range: 62.5pg/ml, Sandwich High Sensitivity, Size: 96wells/kit
Catalog Number: 76172-422
Supplier: Boster Biological Technology


Description: B3GNT8 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: 360-397aa ADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC, Synonyms: Beta-1,3-N-acetylglucosaminyltransferase 8, Beta3Gn-T8, 2.4.1, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76174-188
Supplier: Boster Biological Technology


Description: Stanniocalcin 1/STC1 PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample: cell culture supernates, cell lysates, serum, plasma (heparin, EDTA), Species: Human, Assay: 31.2pg/ml, Sandwich High Sensitivity for Quantitative Detection, Size: 96well/kit
Catalog Number: 76172-498
Supplier: Boster Biological Technology


Description: EAAT2 Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived human EAAT2 recombinant protein, Synonym: Excitatory amino acid transporter 2, SLC1A2, EAAT2, GLT1, Application: WB, Size: 100ug/vial
Catalog Number: 76174-922
Supplier: Boster Biological Technology


Description: S100A8/Calgranulin A PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample: cell culture supernates, cell lysates, serum, plasma (heparin, EDTA), Species: Human, Assay: 31.2pg/ml, Sandwich High Sensitivity for Quantitative Detection, Size: 96well/kit
Catalog Number: 76172-706
Supplier: Boster Biological Technology


Description: PACE4 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Rat, Isotype: IgG, Immunogen: 614-651aa RNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSRMLE, Synonyms: Proprotein convertase subtilisin/kexin type 6, 3.4.21, Application: WB, Size: 100ug/vial
Catalog Number: 76174-354
Supplier: Boster Biological Technology


625 - 640 of 5,847