You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: Sandwich Picokine* ELISA kit of quantitative detection for human ErbB-2 Immunogen: NSO, T23-T652 Assay range: 15.6pg/ml -1000pg/ml Sensitivity: > 10 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum, plasma(heparin, EDTA) and tissue homogenates.
Catalog Number: 10207-694
Supplier: Boster Biological Technology


Description: LKB1 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E.coli-derived human LKB1 recombinant protein (K62-C430), Synonyms: Serine/threonine-protein kinase STK11, Application: Western Blot, size: 100ug/vial
Catalog Number: 76173-374
Supplier: Boster Biological Technology


Description: GDF8/Myostatin/MSTN Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence of GDF8/Myostatin/MSTN, Alternative Names: GDF-8/Myostatin, GDF8, GDF-8, GDF8growth differentiation factor 8, Size: 100ug/vial
Catalog Number: 76464-012
Supplier: Boster Biological Technology


Description: BRCA1 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Immunogen: E.coli-derived human BRCA1 recombinant protein (Position: T1681-E1781, Synonym: Breast cancer type 1 susceptibility protein, 6.3.2.-, BRCA1, RNF53, Application: WB, Size:100ug
Catalog Number: 76170-738
Supplier: Boster Biological Technology


Description: GADD45G Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human GADD45G, Alternative Names: GADD45G, CR6DNA damage-inducible transcript 2 protein, Cytokine-responsive protein CR6, DDIT-2, Size: 100ug/vial
Catalog Number: 76465-388
Supplier: Boster Biological Technology


Description: MBL2/Mannan Binding Lectin Picoband, Polyclonal Antibody, Host: Rabbit, Species: Mouse, Rat, Immunogen: E. Coli-derived rat MBL2 recombinant protein (Position: E19-D244), Synonym: MBP-C, Application: ELISA, IHC-P, WB, Size:100ug
Catalog Number: 76171-266
Supplier: Boster Biological Technology


Description: CTRC ELISA Kit, Sample Volume: 100ul per well, Reactivity: Human, Sensitivity: <20pg/ml, Assay Range: 31.2-2000pg/ml, Immunogen: StandardExpression system: CHO, sequence: V30-L268 Alternative Names: Chymotrypsin C/CTRC, Caldecrin chymotrypsin C (caldecrin), Size: 96wells/kit, with removable strips.
Catalog Number: 76466-872
Supplier: Boster Biological Technology


Description: Relaxin 2 PicoKine* ELISA Kit, Sensitivity: <4pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species: Human, Assay: 7.8pg/ml, Sandwich High Sensitivity ELISA kit for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-328
Supplier: Boster Biological Technology


Description: CD80 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CD80(57-71aa EELAQTRIYWQKEKK), Application: Western Blot, IHC-P
Catalog Number: 10207-148
Supplier: Boster Biological Technology


Description: JAK1 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human JAK1 (78-115aa), Synonym: JAK1, JAK1A, JAK1B, Application: WB, Size:100ug
Catalog Number: 76170-966
Supplier: Boster Biological Technology


Description: VCAM-1 ELISA Kit EZ-Set* (DIY Antibody Pairs), Sample Volume: 100ul per well, Reactivity: Mouse, Sensitivity: <5pg/ml, Assay Range: 156pg/ml-10000pg/ml, Immunogen: StandardExpression system : NSO, F25-E698 Alternative Names: VCAM-1/CD106, CD106 antigen CD106, Size: For 5 plates, 96 wells each
Catalog Number: 76467-186
Supplier: Boster Biological Technology


Description: UPF3B/RENT3B Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 416-452aa SEKTEKKEEVVKRDRIRNKDRPAMQLYQPGARSRNRL, Synonyms: Up-frameshift suppressor 3 homolog on chromosome X, Size: 100ug/vial
Catalog Number: 76174-542
Supplier: Boster Biological Technology


Description: Eph Receptor B1 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: 56-88aa RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE, Synonyms: EPH-2, EPHB1, ELK, EPHT2, HEK6, NET, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76174-024
Supplier: Boster Biological Technology


Description: GST3 / GST pi Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: E. Coli-derived mouse GST3 / GST pi recombinant protein (Position: P2-Q210), Synonym: Gstp1, Gstpib, Application: ELISA, IHC-P, WB, Size:100ug
Catalog Number: 76171-004
Supplier: Boster Biological Technology


Description: MEKK3 Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MEKK3(11-25aa MNDLVALQMNRRHRM), Application: Western Blot
Catalog Number: 10206-946
Supplier: Boster Biological Technology


Description: Human IL10 Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, isotype: IgG, E. coli-derived human IL-10 recombinant protein(Position: S19-N178), for Interleukin-10(IL10) detection. Tested with WB, IHC-P, ELISA in Human
Catalog Number: 10209-330
Supplier: Boster Biological Technology


49 - 64 of 5,847