You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: PXDN Polyclonal Antibody, Host: Rabbit, Reactivity: Zebrafish, Size: 200ul/vial
Catalog Number: 76466-176
Supplier: Boster Biological Technology


Description: SDC1/Syndecan-1, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: 218-251aa ENTAVVAVEPDRRNQSPVDQGATGASQGLLDRKE, Synonyms: Syndecan-1, SYND1, CD138, SDC1, SDC, Application: WB, Purity: Immunogen affinity purified, Size: 100ug/vial
Catalog Number: 76174-302
Supplier: Boster Biological Technology


Description: Beta IG-H3/TGFBI PicoKine* ELISA Kit, Sensitivity: <15pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species: Rat, Assay: 156pg/ml, Sandwich High Sensitivity for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-730
Supplier: Boster Biological Technology


Description: Leupaxin polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Leupaxin(115-129aa KKHLPDKQDHKASLD), different from the related rat sequence by two amino acids
Catalog Number: 10209-448
Supplier: Boster Biological Technology


Description: CD62P/Selp Polyclonal Antibody, Host: Rabbit, Reactivity: Mouse, Rat, Isotype: IgG, Immunogen: E. Coli-derived mouse CD62P recombinant protein (Position: W42-A267), Alternative Names: P-Selectin/CD62P, CD62P antigen, CD62P, FLJ45155, GMP140, Applications: WB, Size: 100ug/vial
Catalog Number: 76464-220
Supplier: Boster Biological Technology


Description: CLEC4C ELISA Kit, Sample Volume: 100ul per well, Reactivity: Human, Sensitivity: <10pg/ml, Assay Range: 15.6pg/ml-1000pg/ml0, Alternative Names: DLEC/CLEC4C/BDCA-2, BDCA2, BDCA-2, BDCA2MGC1257910, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-958
Supplier: Boster Biological Technology


Description: COL18A1/Endostatin Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: E. Coli-derived human COL18A1 recombinant protein, Synonym: Collagen alpha-1(XVIII) chain, Endostatin, COL18A1, Application: ELISA, WB, Size:100ug
Catalog Number: 76171-400
Supplier: Boster Biological Technology


Description: Alpha Actinin 4 Picoband* Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived human Alpha Actinin 4 recombinant protein, Synonym: ACTN4, Application: WB, Size: 100 ug/vial
Catalog Number: 76174-410
Supplier: Boster Biological Technology


Description: SOD3/Ec Sod Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Immunogen: A synthetic peptide corresponding to a sequence of human SOD3 (WTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDD), Synonym: 1.15.1.1, SOD3, Application: IHC-P, Size:100ug
Catalog Number: 76171-508
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Mouse GDNF, Immunogen: sf21, S78-I211, Assay range: 31.2pg/ml-2000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-768
Supplier: Boster Biological Technology


Description: GSTM1 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human GSTM1 (EEEKIRVDILENQTMDNHMQLGMICYNPEFEKLK), Synonym: GSTM1-1, GSTM1a-1a, GSTM1b-1b, GTH4, GSTM1, Size:100ug
Catalog Number: 76171-078
Supplier: Boster Biological Technology


Description: Caspase-10 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CASP10(220-236aa VKTFLEALPRAAVYRMN). Application: IHC-P, WB
Catalog Number: 10206-408
Supplier: Boster Biological Technology


Description: CD44 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CD44(728-742aa DETRNLQNVDMKIGV), different from the related mouse and rat sequences by one amino acid.
Catalog Number: 10209-728
Supplier: Boster Biological Technology


Description: STAM1 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: E. Coli-derived human STAM1 recombinant protein (Position: F9-Q254), Alternative Names: STAM-1, DKFZp686J2352, HSE1 Homolog, signal transducing adapter molecule 1, Application: ELISA, Size: 100ug/vial
Catalog Number: 76463-980
Supplier: Boster Biological Technology


Catalog Number: 10208-960
Supplier: Boster Biological Technology


Description: Cytochrome P450 2D6 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: corresponding to a sequence at the C-terminus of human Cytochrome P450 2D6 (315-347aa), Synonym: CYP2DL1, Application: IHC-P, WB, Size:100ug
Catalog Number: 76170-864
Supplier: Boster Biological Technology


609 - 624 of 5,847