You Searched For: b40


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: 5HT2A Receptor antibody, polyclonal, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor(418-432aa AYKSSQLQMGQKKNS)
Catalog Number: 10207-988
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human TLR2, Immunogen: NSO, E21-L590, Assay range: 156pg/ml-10, 000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-762
Supplier: Boster Biological Technology


Description: Stefin B CSTB Monoclonal Antibody: Clone: 2B6), Host: Mouse, Reactivity: Human, Conjugate: DyLight* 550, Immunogen: E. Coli-derived human Stefin B recombinant protein (Position: M1-F98), Alternative Names: Cystatin B/Stefin B, CPI-B, Size: 50ug/vial
Catalog Number: 76467-878
Supplier: Boster Biological Technology


Description: DC-SIGN Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human DC-SIGN (MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA), Synonym: CLEC4L, Application: IHC-P, WB, Size:100ug
Catalog Number: 76170-884
Supplier: Boster Biological Technology


Description: PSMA2 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Rat, Immunogen: synthetic peptide corresponding to a sequence in the middle region (82-123aa), Synonyms: Proteasome subunit alpha type-2; 3.4.25.1, Application: WB, size: 100ug/vial
Catalog Number: 76173-090
Supplier: Boster Biological Technology


Description: Galectin 1 polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Galectin 1(119-135aa NYMAADGDFKIKCVAFD)
Catalog Number: 10209-360
Supplier: Boster Biological Technology


Description: ALDH1A2 Picoband* Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived human ALDH1A2 recombinant protein, Synonym: RALDH 2, RalDH2, 1.2.1.36, Application: Western blot, Size: 100ug/vial
Catalog Number: 76174-424
Supplier: Boster Biological Technology


Description: GFAP Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: E.coli-derived human GFAP recombinant protein (Position: Q93-M432). Human GFAP shares 94% amino acid (aa) sequence identity with both mouse and rat GFAP, Application: Western Blot, IHC-P
Catalog Number: 10207-464
Supplier: Boster Biological Technology


Description: PER2 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E.coli-derived human PER2 recombinant protein (N13-K330), Synonyms: Period circadian protein homolog 2, Form: Lyophilised, Application: WB, size: 100ug/vial
Catalog Number: 76173-458
Supplier: Boster Biological Technology


Description: CCR5 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived human CCR5 recombinant protein (Position: Q21-K322), Alternative Names: CCR5, C-C CKR-5, C-C motif chemokine receptor 5 A159A, CCCKR5, Applications: ELISA, WB, Size: 100ug/vial
Catalog Number: 76463-480
Supplier: Boster Biological Technology


Description: Ty1 prime-p18 TY1A-BL/TY1B-BL Polyclonal Antibody, Host: Rabbit, Reactivity: Yeast, Size: 200ul/vial
Catalog Number: 76466-312
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for rat IL-1 beta Immunogen: please inquire Assay range: 31.2pg/ml-2000pg/ml Sensitivity: < 1 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum and plasma(heparin, EDTA).
Catalog Number: 10207-692
Supplier: Boster Biological Technology


Description: Tff1 Biotinylated, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Mouse, Concentration Add 0.2ml of distilled water will yield a concentration of 500ug/ml, Synonym: Trefoil factor 1, Protein pS2, Tff1, Bcei, Ps2, Application: ELISA, Size:100ug
Catalog Number: 76171-424
Supplier: Boster Biological Technology


Description: TLS / FUS Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human TLS / FUS (DNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKT), Synonym: FUS, TLS, Application: WB, Size:100ug
Catalog Number: 76171-166
Supplier: Boster Biological Technology


Description: STAT2 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence of STAT2, Alternative Names: STAT2, interferon alpha induced transcriptional activator, ISGF-3, MGC59816, Size: 100ug/vial
Catalog Number: 76464-322
Supplier: Boster Biological Technology


Catalog Number: 10207-584
Supplier: Boster Biological Technology


1,681 - 1,696 of 5,847