You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Mouse CD48, Immunogen: NSO, F23-S217, Assay range: 62.5pg/ml-4000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-806
Supplier: Boster Biological Technology


Description: CUEDC2 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CUEDC2(267-287aa EAEEMKATYINLKPARKYRFH).
Catalog Number: 10206-732
Supplier: Boster Biological Technology


Description: Splicing factor 1 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human splicing factor 1(11-30aa DFPSKKRKRSRWNQDTMEQK)
Catalog Number: 10209-152
Supplier: Boster Biological Technology


Description: HnRNP A1 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HnRNP A1 (8-42aa), Synonym: HNRNPA1, HNRPA1, Application: IHC-P, WB, Size:100ug
Catalog Number: 76171-452
Supplier: Boster Biological Technology


Description: HCN2 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HCN2 (682-714aa), Synonym: BCNG-2, HCN2, BCNG2, Application: IHC-P, WB, Size:100ug
Catalog Number: 76171-670
Supplier: Boster Biological Technology


Description: HEXB Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E.coli-derived human HEXB recombinant protein (K381-M556), Synonyms: Beta-hexosaminidase subunit beta; 3.2.1.52, Application: IHC-P, WB, size: 100ug/vial
Catalog Number: 76173-288
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Mouse LOX-1/OLR1, Immunogen: NSO, R60-I363, Assay range: 31.2pg/ml-2000pg/ml, Sensitivity: < 1 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-398
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human CD320/8D6A, Immunogen: NSO, S36-Y229, Assay range: 156pg/ml-10, 000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum, plasma(heparin, EDTA) and urine, 96-well plate precoated
Catalog Number: 10205-428
Supplier: Boster Biological Technology


Description: CRY2 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 171-200aa RFQAIISRMELPKKPVGLVTSQQMESCRAE, Synonyms: Cryptochrome-2, CRY2, KIAA0658, Application: Western Blot, IHC-P, Size: 100ug/vial
Catalog Number: 76174-008
Supplier: Boster Biological Technology


Description: NM23A Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human NM23A, different from the related mouse sequence by two amino acids and from rat sequence by one amino acid
Catalog Number: 10206-922
Supplier: Boster Biological Technology


Description: GRIA2/Glur2 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human GRIA2 recombinant protein(N25-I360), Synonym: Glutamate receptor 2; GluR-2, Application: IHC-P, WB, size: 100ug/vial
Catalog Number: 76173-276
Supplier: Boster Biological Technology


Description: ATX2 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ATX2(1293-1313aa TTAHFPYMTHPSVQAHHQQQL), identical to the related mouse sequence, Application: Western Blot
Catalog Number: 10207-368
Supplier: Boster Biological Technology


Description: HRP conjugated goat rabbit IgG (gamma-chain specific) secondary antibody. Application: Dotblot, ELISA, WB. Pack Size: 0.5mg
Catalog Number: 10208-902
Supplier: Boster Biological Technology


Description: Myeloblastin ELISA Kit, Sample Volume: 100ul per well, Reactivity: Human, Sensitivity: <10pg/ml, Assay Range: 62.5-4000pg/ml, Immunogen: StandardExpression system : E.coli, sequence: I28-R248 Alternative Names: Proteinase 3/Myeloblastin/PRTN3, ACPA AGP7, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-934
Supplier: Boster Biological Technology


Description: MAP2 antibody, Monoclonal, Host: Mouse IgG, Clone number: MP-2, Synonyms: MAP2A/MAP2B/MAP2C/MAP, DENDRITE-SPECIFIC, Reactivity: Human, Mouse, Rat, Immunogen: Rat brain microtubule-associated proteins(MAPs). Application: IHC-P, WB
Catalog Number: 10206-164
Supplier: Boster Biological Technology


Description: Mineralocorticoid Receptor Antibody, polyclonal, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Isotype:IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Mineralocorticoid Receptor(966-984aa DQLPKVESGNAKPLYFHRK).
Catalog Number: 10205-936
Supplier: Boster Biological Technology


465 - 480 of 5,847