You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: Bikunin/AMBP Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: E. Coli-derived human Bikunin/AMBP recombinant protein (Position: A206-N352), Alternative Names: AMBP, A1M, alpha 1Microglobulin, alpha 1-Microglobulin, Applications: ELISA, Size: 100ug/vial
Catalog Number: 76464-882
Supplier: Boster Biological Technology


Description: Grp75 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 646-679aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ, Synonyms: Stress-70 protein, mitochondrial, 75 kDa glucose-regulated protein, GRP-75, Size: 100ug/vial
Catalog Number: 76174-140
Supplier: Boster Biological Technology


Description: SAA/SAA1 PicoKine* ELISA Kit, Sensitivity: <150pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species: Human, Assay: 1.56ng/ml, Sandwich High Sensitivity ELISA kit for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-686
Supplier: Boster Biological Technology


Description: Monkey Primate GDF5/Bmp 14 PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), Species reactivity: Monkey, Assay Range: 31.2pg/ml, Sandwich High Sensitivity, Size: 96wells/kit
Catalog Number: 76172-624
Supplier: Boster Biological Technology


Description: TIMP4 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TIMP4(208-224aa YRGHLPLRKEFVDIVQP).
Catalog Number: 10206-778
Supplier: Boster Biological Technology


Description: CCL4 Polyclonal Antibody, Host: Rabbit, Species: Rat, Isotype: IgG, Immunogen: E.coli-derived rat CCL4 recombinant protein (Position: A24-N92). Rat CCL4 shares 80% and 86% amino acid (aa) sequences identity with human and mouse CCL4, respectively, Application: Western Blot
Catalog Number: 10207-452
Supplier: Boster Biological Technology


Description: Human IL4 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Immunogen: E. coli-derived human IL-4 recombinant protein(Position: H25-S153). Application: ELISA, Neu, IP, IHC-P, WB
Catalog Number: 10206-456
Supplier: Boster Biological Technology


Description: K-Cadherin-6 ELISA Kit, Reactivity: Human, Sample Type: cell culture supernatants, serum and plasma (heparin, EDTA, citrate), Sample Volume: 100ul per well, Sensitivity: <50pg/ml, Assay Range: 156-10000pg/ml, Alternative Names: K-cadherin (fetal kidney), Size: 96wells/kit, with removable strips.
Catalog Number: 76467-058
Supplier: Boster Biological Technology


Description: RAP1A Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Rat, Isotype: IgG, Immunogen: 156-181aa EIFYDLVRQINRKTPVEKKKPKKKSC, Synonyms: Ras-related protein Krev-1, RAP1A, KREV1, Application: Western Blot, Size: 100ug/vial
Catalog Number: 76174-488
Supplier: Boster Biological Technology


Description: IL-1 beta ELISA Kit EZ-Set* (DIY Antibody Pairs), Sample Volume: 100ul per well, Reactivity: Human, Sensitivity: <0.15pg/ml, Assay Range: 3.9-250pg/ml, Immunogen: StandardExpression system : E.coli,A117-S269 Alternative Names: IL-1 beta/IL-1F2, catabolin IL1 beta, Size: For 5 plates, 96 wells each
Catalog Number: 76467-134
Supplier: Boster Biological Technology


Description: IFN gamma ELISA Kit EZ-Set* (DIY Antibody Pairs), Sample Volume: 100ul per well, Reactivity: Rat, Sensitivity: <6pg/ml, Assay Range: 31.2-2000pg/ml, Immunogen: StandardExpression system : E.coli, E23-C156, Alternative Name: IFN-gamma, IFG, IFI, IFNG, IFNgamma, Size: For 5 plates, 96 wells each
Catalog Number: 76467-126
Supplier: Boster Biological Technology


Description: FGF8 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human FGF8(163-185aa FMKRLPRGHHTTEQSLRFEFLNY), identical to the related rat and mouse sequences, Application:, IHC-P
Catalog Number: 10207-110
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Mouse NGF/NGF beta, Immunogen: NSO, S122-G241, Assay range: 31.2pg/ml-2000pg/ml, Sensitivity: < 1 pg/ml, Sample type: cell culture supernates and serum, 96-well plate precoated
Catalog Number: 10205-278
Supplier: Boster Biological Technology


Description: MCL1 polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MCL1(303-325aa RDWLVKQRGWDGFVEFFHVEDLE), different from the related mouse sequence by one amino acid.
Catalog Number: 10209-758
Supplier: Boster Biological Technology


Description: RAB14 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Rat, Isotype: IgG, Immunogen: 124-153aa NKADLEAQRDVTYEEAKQFAEENGLLFLEA, Synonyms: Ras-related protein Rab-14, RAB14, Application: Western Blot, storage: -20 deg C, size: 100ug/vial
Catalog Number: 76174-486
Supplier: Boster Biological Technology


Description: Marapsin/Pancresin PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates and serum, Species reactivity: Human, Assay Range: 125pg/ml, Sandwich High Sensitivity ELISA kit for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-580
Supplier: Boster Biological Technology