Print…

You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,846  results were found

Refine Results Sort by
SearchResultCount:"5846"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-10206-314

Anti-Neurotrophin 3 Rabbit Polyclonal Antibody

Catalog Number: (10206-314)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for Neurotrophin-3(NTF3) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Product Image-10210-032

Anti-EDA Rabbit Polyclonal Antibody

Catalog Number: (10210-032)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for Ectodysplasin-A(EDA) detection. Tested with WB in Human;Mouse;Rat.
Image Unavailable-76172-094

Bovine BMP-5 PicoKine; ELISA Kit, Boster Biological Technology

Catalog Number: (76172-094)
Supplier: Boster Biological Technology
Description: Sandwich High Sensitivity ELISA kit for Quantitative Detection of Bovine BMP-5
Product Image-10209-262

Anti-Kallikrein 1 Rabbit Polyclonal Antibody

Catalog Number: (10209-262)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for Kallikrein-1(KLK1) detection. Tested with WB, IHC-P in Mouse.
Product Image-10205-742

Human NT-4 PicoKine ELISA Kit, Boster

Catalog Number: (10205-742)
Supplier: Boster Biological Technology
Description: Sandwich ELISA kit of Quantitative Detection for Human NT-4
Product Image-76173-468

Anti-OCT1 Polyclonal Antibody

Catalog Number: (76173-468)
Supplier: Boster Biological Technology
Description: Polyclonal antibody for POU2F1 detection. Host: Rabbit.Size: 100μg/vial. Tested applications: IHC-P. Reactive species: Human. POU2F1 information: Molecular Weight: 76472 MW; Subcellular Localization: Nucleus; Tissue Specificity: Ubiquitous. Isoform 2 is lymphocyte-specific.
Image Unavailable-76174-792

Anti-SMURF2 IgG Polyclonal Antibody

Catalog Number: (76174-792)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase SMURF2(SMURF2) detection. Tested with WB in Human.
Image Unavailable-10209-888

Protein A,Biotin

Catalog Number: (10209-888)
Supplier: Boster Biological Technology
Image Unavailable-76466-242

Anti-EMB2001 Rabbit Polyclonal Antibody

Catalog Number: (76466-242)
Supplier: Boster Biological Technology
Description: At2g22870 EMB2001 Polyclonal Antibody, Host: Rabbit, Reactivity: Mouse-ear cress, Size: 200ul/vial
Image Unavailable-76172-074

Bovine Activin A PicoKine; ELISA Kit, Boster Biological Technology

Catalog Number: (76172-074)
Supplier: Boster Biological Technology
Description: Sandwich High Sensitivity ELISA kit for Quantitative Detection of Bovine Activin A
Product Image-10205-370

Mouse Cystatin C PicoKine ELISA Kit, Boster

Catalog Number: (10205-370)
Supplier: Boster Biological Technology
Description: Sandwich ELISA kit of Quantitative Detection for Mouse Cystatin C
Image Unavailable-76467-832

Anti-KRT19 Mouse Monoclonal Antibody [clone: 3D4]

Catalog Number: (76467-832)
Supplier: Boster Biological Technology
Description: Cytokein 19 KRT19 Monoclonal Antibody, Clone: 3D4, Host: Mouse, Reactivity: Human, Immunogen: A synthetic peptide corresponding to sequence at C-terminus of Cytokeratin 19 (334-372aa QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR), Alternative Names: 40-kDa keratin intermediate filament, Size: 100ug/vial
Image Unavailable-10207-156

Anti-MAP2K3 Rabbit Polyclonal Antibody

Catalog Number: (10207-156)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for Dual specificity mitogen-activated protein kinase kinase 3(MAP2K3) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Image Unavailable-76466-794

Human Complement C1R PicoKine; ELISA Kit, Boster

Catalog Number: (76466-794)
Supplier: Boster Biological Technology
Description: Sandwich High Sensitivity ELISA kit for quantitative detection of human C1R. 96 wells/kit, with removable strips.
Product Image-76173-330

Anti-NR3C1 Polyclonal Antibody

Catalog Number: (76173-330)
Supplier: Boster Biological Technology
Description: Polyclonal antibody for GLUCOCORTICOID RECEPTOR/NR3C1 detection. Host: Rabbit.Size: 100μg/vial. Tested applications: IHC-P. Reactive species: Human. GLUCOCORTICOID RECEPTOR/NR3C1 information: Molecular Weight: 85659 MW; Subcellular Localization: Cytoplasm . Mitochondrion. Nucleus . Cytoplasmic in the absence of ligand, nuclear after ligand- binding; Tissue Specificity: Widely expressed. In the heart, detected in left and right atria, left and right ventricles, aorta, apex, intraventricular septum, and atrioventricular node as well as whole adult and fetal heart.
Product Image-10206-898

Anti-STRA8 Rabbit Polyclonal Antibody

Catalog Number: (10206-898)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for Stimulated by retinoic acid gene 8 protein homolog(STRA8) detection. Tested with WB in Human.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
385 - 400 of 5,846
no targeter for Bottom