You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: SHIP/INPP5D Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: synthetic peptide corresponding to sequence of human SHIP (NEDDKFTVQASEGVSMRFFTKLDQLIEFYKKENMGLVTHLQ, Alternative Names: SHIP, 145kD, EC 3.1.3, hp51CNMGC142142, Application: WB, Size: 100ug/vial
Catalog Number: 76465-172
Supplier: Boster Biological Technology


Description: ADAM10 antibody, polyclonal, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ADAM10(612-627aa SVQWSRHFSGRTITLQ).Application: WB
Catalog Number: 10208-036
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Mouse Prolactin, Immunogen: E.coli, L32-C228, Assay range: 156pg/ml-10, 000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, citrate), 96-well plate precoated
Catalog Number: 10205-470
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for human IL-15 Immunogen: E.coli, N49-S162 Assay range: 15.6pg/ml-1000pg/ml Sensitivity: < 3 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum and plasma(heparin, EDTA).
Catalog Number: 10207-764
Supplier: Boster Biological Technology


Description: Menin Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Immunogen: E.coli-derived human Menin recombinant protein (P301-L615), Synonyms: Menin; MEN1; SCG2, Form: Lyophilised, Application: Western Blot, size: 100ug/vial
Catalog Number: 76173-360
Supplier: Boster Biological Technology


Description: VEGF-B ELISA Kit (DIY Antibody Pairs), Sample Volume: 100ul per well, Reactivity: Mouse, Sensitivity: <2pg/ml, Assay Range: 31.2pg/ml-2000pg/ml, Immunogen: StandardExpression system : sf21,Q20-A207&Q20-R148 Alternative Names: vascular endothelial growth factor B, Size: For 5 plates, 96 wells each
Catalog Number: 76467-266
Supplier: Boster Biological Technology


Description: CIITA Picoband* Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived human CIITA recombinant protein, Synonym: MHC class II transactivator, Application: WB, IHC-P, Size: 100 ug/vial
Catalog Number: 76174-852
Supplier: Boster Biological Technology


Description: IRF5 Polyclonal Antibody, Host: Rabbit, Species: Human Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IRF5, identical to the related rat sequence, and different from the related mouse sequence by two amino acids
Catalog Number: 10207-414
Supplier: Boster Biological Technology


Description: Ubiquitin Picoband* Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, isotype: IgG, E.coli-derived human Ubiquitin recombinant protein (Position: M77-G152)
Catalog Number: 10209-438
Supplier: Boster Biological Technology


Description: PLA2G2A ELISA Kit, Sample Volume: 100ul per well, Reactivity: Mouse, Sensitivity: <10pg/ml, Assay Range: 31.2pg/ml-2000pg/ml, Immunogen: StandardExpression system for standard: NSO, sequence: N22-C146 Alternative Names: Pla2g2a, EC 3.1.1.4, GIIC sPLA2, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-778
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Mouse IL-12(p40), Immunogen: sf21, M23-S335, Assay range: 15.6pg/ml-1000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA, citrate), 96-well plate precoated
Catalog Number: 10205-408
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for human TGF beta 1 Immunogen: CHO, A279-S390 Assay range: 15.6pg/ml-1000pg/ml Sensitivity: < 1 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum, plasma(EDTA) and urine.
Catalog Number: 10207-642
Supplier: Boster Biological Technology


Description: SPHK1/Sphingosine Kinase 1 PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample: cell culture supernates, cell lysates, serum and plasma, Species: Human, Assay: 312pg/ml, Sandwich High Sensitivity for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-606
Supplier: Boster Biological Technology


Description: HMGB1/Hmg 1 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HMGB1 (124-154aa), Synonym: High mobility group protein B1, Application: IHC-P, WB, Size:100ug
Catalog Number: 76170-778
Supplier: Boster Biological Technology


Description: Bcl-2 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: E. Coli-derived human Bcl-2 recombinant protein (Position: Q118-E165), Synonym: Apoptosis regulator Bcl-2, BCL2, Application: ELISA, IHC-P, WB, Size:100ug
Catalog Number: 76170-764
Supplier: Boster Biological Technology


Description: Galactosidase alpha/Gla Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence of Galactosidase alpha/Gla, Alternative Names: alpha-Galactosidase A/GLA, agalsidase alfa, Agalsidase alpha, Agalsidase, Size: 100ug/vial
Catalog Number: 76464-158
Supplier: Boster Biological Technology


369 - 384 of 5,847