You Searched For: ACS Scientific Inc


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human Laminin, Immunogen: from human fibroblasts, Assay range: 156pg/ml-10, 000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-558
Supplier: Boster Biological Technology


Description: STNFsR II, Polyclonal Antibody, Host: Rabbit, Species: Mouse, Rat, Isotype: IgG, Immunogen: 296-324aa QRDAKVPHVPDEKSQDAVGLEQQHLLTTA, Synonyms: Tumor necrosis factor receptor superfamily member 1B, Application: Western Blot, IHC-P, Size: 100ug/vial
Catalog Number: 76173-898
Supplier: Boster Biological Technology


Description: Connexin 45/GJA7 antibody, polyclonal, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Connexin 45(308-322aa KIAYKQNKANTAQEQ)
Catalog Number: 10207-972
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for human PDGF-AB Immunogen: E.coli, (S87-T211)+(S82-T190) Assay range: 31.2pg/ml-2000pg/ml Sensitivity: < 2 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum and plasma(heparin, EDTA).
Catalog Number: 10209-004
Supplier: Boster Biological Technology


Description: GAPDH Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human GAPDH recombinant protein (Position: N136-E335, Synonym: Glyceraldehyde-3-phosphate dehydrogenase, Application: IHC-P, WB, Size:100ug
Catalog Number: 76170-914
Supplier: Boster Biological Technology


Description: MASPIN Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human MASPIN recombinant protein(M1-A350), Synonym: Serpin B5; Maspin; Peptidase inhibitor 5; PI-5; SERPINB5, Application: WB, size: 100ug/vial
Catalog Number: 76173-546
Supplier: Boster Biological Technology


Description: IGFBP3 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: E. Coli-derived human IGFBP3 recombinant protein (Position: A29-K267), Synonym: Insulin-like growth factor-binding protein 3, Application: ELISA, WB, Size:100ug
Catalog Number: 76171-036
Supplier: Boster Biological Technology


Description: ATX2 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 1283-1313aa QSALQPIPVSTTAHFPYMTHPSVQAHHQQQL, Synonyms: Ataxin-2, Spinocerebellar ataxia type 2 protein, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76173-834
Supplier: Boster Biological Technology


Description: FABP2 ELISA Kit EZ-Set* (DIY Antibody Pairs), Sample Volume: 100ul per well, Reactivity: Mouse, Sensitivity: <10pg/ml, Assay Range: 31.2pg/ml-2000pg/ml, Immunogen: StandardExpression system : E.coli,A2-E132 Alternative Names: FABP2/I-FABP, FABP2 FABPI, Size: For 5 plates, 96 wells each
Catalog Number: 76467-292
Supplier: Boster Biological Technology


Description: Fascin Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Rat, Isotype: IgG, Immunogen: 42-73aa KKQIWTLEQPPDEAGSAAVCLRSHLGRYLAAD, Synonyms: Singed-like protein, p55, FSCN1, FAN1, HSN, SNL, Application: WB, Size: 100ug/vial
Catalog Number: 76174-040
Supplier: Boster Biological Technology


Description: P27Kip1 antibody, Monoclonal, Host: Mouse IgG1, Clone number: IMD-27, Synonyms: KIP1/MEN4/CDKN4/MEN1B/P27KIP1/Cyclin-dependent kinase inhibitor p27, Reactivity: Human, Mouse, Rat, Immunogen: recombinant rodent p27Kip1 protein. Application: ICC, WB
Catalog Number: 10206-068
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* elisa kit of Quantitative Detection for Human Galectin-3/LGALS3 Immunogen: E.coli, A2-I250 Assay range: 156pg/ml-10, 000pg/ml Sensitivity: < 10 pg/ml, Sample Type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10209-902
Supplier: Boster Biological Technology


Description: Picoband*Vitamin D Binding Protein Polyclonal antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: E. Coli-derived human Vitamin D Binding protein recombinant protein, Synonyms: Vitamin D-binding protein, Uses: IHC-P, WB, Size: 100ug/vial
Catalog Number: 76171-742
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for human uPAR Immunogen: please inquire Assay range: 62.5pg/ml-4000pg/ml Sensitivity: < 4 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum, plasma(heparin, EDTA) and urine.
Catalog Number: 10207-806
Supplier: Boster Biological Technology


Description: E2F3 Polyclonal Antibody, Host: Rabbit, Species: Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human E2F3(446-465aa DLFDAYDLEKLPLVEDFMCS), identical to the related mouse sequence, Application: Western Blot
Catalog Number: 10207-398
Supplier: Boster Biological Technology


Description: Picoband*Annexin VIII Polyclonal antibody, Host: Rabbit, Species: Human, Immunogen: Synthetic peptide corresponding to a sequence at the N-terminus of human Annexin VIII, Synonym: Annexin A8, Annexin VIII, Annexin-8, Uses: WB, Size: 100ug/vial
Catalog Number: 76172-014
Supplier: Boster Biological Technology


1 - 16 of 5,847