You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: Cytochrome P450 2D6 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: corresponding to a sequence at the C-terminus of human Cytochrome P450 2D6 (315-347aa), Synonym: CYP2DL1, Application: IHC-P, WB, Size:100ug
Catalog Number: 76170-864
Supplier: Boster Biological Technology


Description: STAM1 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: E. Coli-derived human STAM1 recombinant protein (Position: F9-Q254), Alternative Names: STAM-1, DKFZp686J2352, HSE1 Homolog, signal transducing adapter molecule 1, Application: ELISA, Size: 100ug/vial
Catalog Number: 76463-980
Supplier: Boster Biological Technology


Description: Monkey Primate TNFSF13/APRIL PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), Species reactivity: Monkey, Assay: 156pg/ml, Sandwich High Sensitivity, Size: 96wells/kit
Catalog Number: 76172-262
Supplier: Boster Biological Technology


Description: LDHB/Lactate Dehydrogenase B Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: E. Coli-derived human LDHB recombinant protein(E237-L334), Synonym: LDH-B; 1.1.1.27, Application: WB, size: 100ug/vial
Catalog Number: 76173-066
Supplier: Boster Biological Technology


Description: CD44 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CD44(728-742aa DETRNLQNVDMKIGV), different from the related mouse and rat sequences by one amino acid.
Catalog Number: 10209-728
Supplier: Boster Biological Technology


Description: BMP-6 PicoKine* ELISA Sandwich High Sensitivity Kit, Species: Rat, Sample Type: bone tissue, cell culture supernates and serum, Sensitivity: <10pg/ml, Assay Range 156pg/ml-10000pg/ml, Store at 4 degree C, Size: 96wells, with removable strips
Catalog Number: 76172-760
Supplier: Boster Biological Technology


Description: IFNGR1/Cd119 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human IFNGR1 (108-147aa), Synonym: IFNGR1, Application: WB, Size:100ug
Catalog Number: 76171-484
Supplier: Boster Biological Technology


Description: TCPTP Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Rat, Isotype: IgG, Immunogen: E.coli-derived human TCPTP recombinant protein, Synonyms: Tyrosine-protein phosphatase non-receptor type 2, 3.1.3.48, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76173-870
Supplier: Boster Biological Technology


Description: Picoband*ACSL3 Polyclonal antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E.coli-derived human ACSL3 recombinant protein, Synonyms: Long-chain-fatty-acid--CoA ligase 3, 6.2.1.3, Application: WB, Storage: -20 to 4 deg C, Size: 100ug/vial
Catalog Number: 76171-896
Supplier: Boster Biological Technology


Description: CCT3/Tcp 1 Gamma Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Rat, Isotype: IgG, Immunogen: 497-536aa EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ, Synonyms: TCP-1-gamma, CCT-gamma, hTRiC5, CCT3, CCTG, TRIC5, Size: 100ug/vial
Catalog Number: 76174-690
Supplier: Boster Biological Technology


Description: B2M ELISA Kit, Reactivity: Human, Sample Type: cell culture supernatants, serum, plasma, saliva, urine and human milk, Sample Volume: 100ul per well, Sensitivity: <10pg/ml, Assay Range: 156-10000pg/ml, Alternative Names: beta 2-Microglobulin, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-514
Supplier: Boster Biological Technology


Description: PU.1/Spi1 Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived human PU.1/Spi1 recombinant protein, Synonym: Transcription factor PU.1, Application: Immunohistochemistry-P, Size: 100ug/vial
Catalog Number: 76174-980
Supplier: Boster Biological Technology


Description: EYS Polyclonal Antibody, Host: Rabbit, Reactivity: Zebrafish, Size: 200ul/vial
Catalog Number: 76466-178
Supplier: Boster Biological Technology


Description: AIMP2/p38 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human AIMP2/p38(298-320aa NVQRWMRSCENLAPFNTALKLLK).
Catalog Number: 10206-486
Supplier: Boster Biological Technology


Description: FRA2 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Rat, Isotype: IgG, Immunogen: 96-127aa ALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKR, Synonyms: Fos-related antigen 2, FRA-2, FOSL2, FRA2, Application: Western Blot, Size: 100ug/vial
Catalog Number: 76174-038
Supplier: Boster Biological Technology


Description: Bovine TGF-Beta 3 PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, serum, plasma(EDTA) and urine, Species reactivity: Bovine, Assay Range: 31.2pg/ml, Sandwich High Sensitivity, Immunogen: A301-S412, Size: 96wells/kit
Catalog Number: 76172-314
Supplier: Boster Biological Technology


305 - 320 of 5,847