You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: ANTXR2 ELISA Kit, Sample Volume: 100ul per well, Reactivity: Mouse, Sensitivity: <50pg/ml, Assay Range: 156pg/ml-10000pg/ml, Alternative Names: CMG-2/ANTXR2, anthrax toxin receptor 2, ANTXR2, Capillary morphogenesis gene 2 protein, Size: 96wells/kit, with removable strips.
Catalog Number: 76467-104
Supplier: Boster Biological Technology


Description: CD19 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: 307-337aa LVGILHLQRALVLRRKRKRMTDPTRRFFKVT, Synonyms: B-lymphocyte antigen CD19, B-lymphocyte surface antigen B4, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76174-456
Supplier: Boster Biological Technology


Description: Periostin antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of mouse Periostin(24-41aa NSYYDKVLAHSRIRGRDQ).
Catalog Number: 10206-510
Supplier: Boster Biological Technology


Description: Synapsin II Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: E. Coli-derived human Synapsin II recombinant protein (A497-D582), Synonyms: Synapsin-2; Synapsin II; SYN2, Application: WB, size: 100ug/vial
Catalog Number: 76173-114
Supplier: Boster Biological Technology


Description: Biotin Conjugated Goat Anti-rabbit IgG secondary antibody This biotin conjugated antibody is specific for rabbit IgG and shows no cross-reactivity with bovine/mouse IgG, Application: ELISA, IHC-P, IHC-F, ICC, WesternBlot, Pack size: 1mg
Catalog Number: 10207-522
Supplier: Boster Biological Technology


Description: EAAT1 Picoband* PAB, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human EAAT1 (14-42aa ), Synonym: SLC1A3, EAAT1, GLAST, Application: WB, Size: 100ug/vial
Catalog Number: 76174-756
Supplier: Boster Biological Technology


Description: REG3A ELISA Kit, Sample Volume: 100ul per well, Reactivity: Human, Sensitivity: <0.1ng/ml, Assay Range: 0.78ng/ml-50ng/ml, Alternative Names: REG3A, hepatocarcinoma-intestine-pancreas, HIPpancreatitis-associated protein, Human proislet peptide, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-652
Supplier: Boster Biological Technology


Description: Dynamin 1 DNM1 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Conjugate: DyLight* 488, Immunogen: E. Coli-derived human Dynamin 1 recombinant protein (Position: W616-D667), Alternative Names: Dynamin, DNM, DNM1, dynamin 1, Dynamin, Application: Flow Cytometry, Size: 50ug/vial
Catalog Number: 76464-924
Supplier: Boster Biological Technology


Description: TLR7 Picoband* Polyclonal Antibody, Species reactivity: Human, Mouse, Rat, Immunogen: synthetic peptide corresponding to a sequence at the C-terminus of human TLR7 (1020-1047aa), Synonyms: Toll-like receptor 7; TLR7, Application: WB, size: 100ug/vial
Catalog Number: 76173-734
Supplier: Boster Biological Technology


Description: TFPI PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species reactivity: Mouse, Assay: 156pg/ml, Sandwich High Sensitivity ELISA kit for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-430
Supplier: Boster Biological Technology


Description: BAFF Receptor/Tnfrsf13c Polyclonal Antibody, Host: Rabbit, Reactivity: Mouse, Rat, Isotype: IgG, Immunogen: E. Coli-derived mouse BAFF Receptor recombinant protein (Position: M1-A71), Alternative Names: BAFFR/TNFRSF13C, BAFF R, BAFFR, BR3, CD268, Applications: ELISA, WB, Size: 100ug/vial
Catalog Number: 76465-038
Supplier: Boster Biological Technology


Description: CTNNA1/Alpha 1 Catenin Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human CTNNA1 recombinant protein (D143-D292), Synonyms: Alpha E-catenin, Application: Western blot, size: 100ug/vial
Catalog Number: 76173-160
Supplier: Boster Biological Technology


Description: Picoband*SLC7A3/Cat3 Polyclonal antibody, Host: Rabbit, Species: Human, Immunogen: Synthetic peptide corresponding to a sequence at N-terminus of human SLC7A3, Synonym: Cationic amino acid transporter 3, CAT-3, CAT3, Uses: WB, Size: 100ug/vial
Catalog Number: 76172-036
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Mouse Laminin, Immunogen: from murine sarcoma basement membrane, Range: 156pg/ml -10, 000pg/ml, Sensitivity: > 10pg/ml, Sample: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-560
Supplier: Boster Biological Technology


Description: ADIPOR1/Adiponectin Receptor 1 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Rat, Immunogen: synthetic peptide corresponding to sequence at N-terminus (51-78aa), Synonyms: CGI-45, Application: WB, size: 100ug/vial
Catalog Number: 76173-668
Supplier: Boster Biological Technology


Description: Factor D Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: E. Coli-derived human Factor D recombinant protein (Position: I26-A253), Synonym: CFD, DF, PFD, Application: ELISA, IHC-P, WB, Size:100ug
Catalog Number: 76171-328
Supplier: Boster Biological Technology


289 - 304 of 5,847