You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: CD11b polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CD11b(177-192aa MEQLKKSKTLFSLMQY)
Catalog Number: 10209-628
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for human CD163 Immunogen: NSO, G41-S1045 Assay range: 1.56ng/ml-100ng/ml Sensitivity: < 150 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum and plasma(heparin).
Catalog Number: 10207-818
Supplier: Boster Biological Technology


Description: Syndecan-1/SDC1 PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma(heparin, EDTA), Species: Mouse, Assay: 156pg/ml, Sandwich High Sensitivity for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-698
Supplier: Boster Biological Technology


Description: Annexin A10 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Annexin A10(308-324aa HYKKALLAICAGDAEDY).
Catalog Number: 10206-388
Supplier: Boster Biological Technology


Description: HSP25 antibody, monoclonal, Clone: SJ-25, Host: Mouse, Isotype: IgG, Species reactivity: Human, Immunogen: Partially purified inhibitor of actin polymerization(IAP) protein from turkey gizzard smooth muscle.Application: WB, IHC-P, IHC-F, ICC
Catalog Number: 10207-942
Supplier: Boster Biological Technology


Description: RNA polymerase II Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Monkey, Mouse, Rat, Immunogen: E.coli-derived RNA polymerase II/POLR2A recombinant protein (Position: D10-E321). Alternative Names: RNA Polymerase II/POLR2A, DNA-directed RNA polymerase II largest subunit, Size: 100ug/vial
Catalog Number: 76464-106
Supplier: Boster Biological Technology


Description: CD20 Picoband* Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, isotype: IgG, E.coli-derived human CD20 recombinant protein (Position: M1-D261). Human CD20 shares 75% amino acid (aa) sequence identity with mouse CD20
Catalog Number: 10209-700
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Mouse TNFRSF17/BCMA, Immunogen: NSO, M1-T49, Assay range: 31.2pg/ml-2000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-250
Supplier: Boster Biological Technology


Description: NF68 antibody, Monoclonal, Host: Mouse IgG, Clone number: NF-68, Synonyms: NFL/NF-L/NF68/CMT1F/CMT2E/68 kDa neurofilament protein/Neurofilament triplet L protein, Reactivity: Human, Pig, Rat, Immunogen: Pig spinal cord. Application: IHC-P, IHC-F, WB
Catalog Number: 10206-170
Supplier: Boster Biological Technology


Description: FABP2/I-FABP Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived mouse FABP2/I-FABP recombinant protein (Position: A2-E132, Synonym: I-FABP, Fabp2, Fabpi, Application: IHC-P, WB, Size:100ug
Catalog Number: 76171-612
Supplier: Boster Biological Technology


Description: Transcription factor Sp4 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Transcription factor Sp4(29-44aa ENNNKKPKTSGSQDSQ).
Catalog Number: 10205-976
Supplier: Boster Biological Technology


Description: Protein C antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Protein C(446-461aa HGHIRDKEAPQKSWAP). Application: IHC-P, WB
Catalog Number: 10206-492
Supplier: Boster Biological Technology


Description: FGF1/Fgf Acidic Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: E. Coli-derived human FGF1 recombinant protein, Synonyms: Fibroblast growth factor 1, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76174-726
Supplier: Boster Biological Technology


Description: KLK1 ELISA Kit EZ-Set* (DIY Antibody Pairs), Sample Volume: 100ul per well, Reactivity: Human, Sensitivity: <10pg/ml, Assay Range: 156pg/ml-10000pg/ml, Immunogen: StandardExpression system : NSO, I25-S262 Alternative Names: Kallikrein 1, EC 3.4.21 EC 3.4.21.35, Size: For 5 plates, 96 wells each
Catalog Number: 76467-232
Supplier: Boster Biological Technology


Description: ADRA1A Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 335-373aa KAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKD, Synonyms: Alpha-1A adrenergic receptor, Alpha-1A adrenoreceptor, Alpha-1A adrenoceptor, Size: 100ug/vial
Catalog Number: 76174-320
Supplier: Boster Biological Technology


Description: P2RX4/P2X4 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E.coli-derived human P2RX4 recombinant protein (N262-Q388), Synonyms: P2X purinoceptor 4, Form: Lyophilised, Application: WB, size: 100ug/vial
Catalog Number: 76173-442
Supplier: Boster Biological Technology


273 - 288 of 5,847