You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: NNOS(neuronal) antibody, polyclonal, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human nNOS(neuronal)(1418-1434aa IAFIEESKKDTDEVFSS)
Catalog Number: 10207-982
Supplier: Boster Biological Technology


Description: Neuregulin-1/NRG1-Beta1 PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species: Human, Assay: 62.5pg/ml, For Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-470
Supplier: Boster Biological Technology


Description: CD134/OX40 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of rat CD134(23-42aa KLNCVKDTYPSGHKCCRECQ). Application: WB
Catalog Number: 10206-428
Supplier: Boster Biological Technology


Description: KLK1/Kallikrein 1 PicoKine* ELISA Kit, Sensitivity: <12pg/ml, Sample: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species: Mouse, Assay: 62.5pg/ml, Sandwich High Sensitivity for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-748
Supplier: Boster Biological Technology


Description: NIRF Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 15-54aa TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLEN, Synonyms: Np95-like RING finger protein, Nuclear protein 97, Nuclear zinc, Size: 100ug/vial
Catalog Number: 76174-652
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Rat Cystatin C, Immunogen: NSO, M1-A140, Assay range: 312pg/ml-20, 000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum, plasma(heparin, EDTA) and urine, 96-well plate precoated
Catalog Number: 10205-538
Supplier: Boster Biological Technology


Description: Complement C9 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Immunogen: E. Coli-derived human Complement C9 recombinant protein (Position: K289-N515), Synonym: C9, Application: ELISA, WB, Size:100ug
Catalog Number: 76170-878
Supplier: Boster Biological Technology


Description: HnRNP D Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived hnRNP D/AUF1/HNRNPD recombinant protein, Alternative Names: AUF1, AUF1A, heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein1, 37kDa), Size: 100ug/vial
Catalog Number: 76465-826
Supplier: Boster Biological Technology


Description: BTG2 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence of BTG2 (EQRLKVFSGALQEALTEHYKHHWFPEK), Alternative Names: BTG2, B-cell translocation gene 2, BTG family member 2, BTG family, member 2, Size: 100ug/vial
Catalog Number: 76464-390
Supplier: Boster Biological Technology


Description: Progesterone Receptor antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Progesterone Receptor(536-553aa QVYPPYLNYLRPDSEASQ).
Catalog Number: 10206-046
Supplier: Boster Biological Technology


Description: FGF21 ELISA Kit, Sample Volume: 100ul per well, Reactivity: Rat, Sensitivity: <10pg/ml, Assay Range: 31.2pg/ml-2000pg/ml, Immunogen: /StandardExpression system for standard: E.coli, Immunogen: sequence: Y30-S20800, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-410
Supplier: Boster Biological Technology


Description: Cofilin Picoband* antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human Cofilin recombinant protein (Position: A2-L166).
Catalog Number: 10206-668
Supplier: Boster Biological Technology


Description: KIM1 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TIM 1 (321-359aa), Synonym: Hepatitis A virus cellular receptor 1, Application: WB, Size: 100 ug/vial
Catalog Number: 76174-974
Supplier: Boster Biological Technology


Description: Plectin Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: synthetic peptide corresponding to a sequence in the middle region (2644-2671aa), Synonyms: Plectin; PCN; PLTN, Application: WB, size: 100ug/vial
Catalog Number: 76173-692
Supplier: Boster Biological Technology


Description: GAD65 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: E. Coli-derived human GAD65 recombinant protein (Position: K84-L182), Synonym: Glutamate decarboxylase 2, GAD65, Application: ELISA, IHC-P, WB, Size:100ug
Catalog Number: 76171-716
Supplier: Boster Biological Technology


Description: GFRA1/Gfr Alpha 1 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E.coli-derived human GFRA1 recombinant protein(D25-Q227), Synonym: GDNF family receptor alpha-1, Application: IHC-P, WB, size: 100ug/vial
Catalog Number: 76173-270
Supplier: Boster Biological Technology


257 - 272 of 5,847