You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: LOXL1 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: 397-425aa AEEKCLASTAYAPEATDYDVRVLLRFPQR, Synonyms: Lysyl oxidase homolog 1, 1.4.3.-, Lysyl oxidase-like protein 1, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76174-254
Supplier: Boster Biological Technology


Description: ADAMTS13 EZ-Set* ELISA Kit (DIY Antibody Pairs), Species: Human, Sensitivity: <20pg/ml, Sample Type: cell culture supernates, serum and plasma(heparin, EDTA, citrate), Assay Range: 0.78ng/ml-50ng/ml, Size: For 5 plates, 96 wells
Catalog Number: 76172-844
Supplier: Boster Biological Technology


Description: Rabbit TGF Alpha PicoKine* ELISA Kit, Sensitivity: <1pg/ml, Sample type: cell culture supernates, serum, plasma(heparin, EDTA) and rabbit milk, Species reactivity: Rabbit, Assay Range: 15.6pg/ml, Sandwich High Sensitivity, Size: 96wells/kit
Catalog Number: 76172-142
Supplier: Boster Biological Technology


Description: LBP Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human LBP recombinant protein (Position: L177-E446, Synonym: Lipopolysaccharide-binding protein, LBP, LBP, Application: WB, Size:100ug
Catalog Number: 76171-174
Supplier: Boster Biological Technology


Description: Frizzled 4 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human Frizzled 4 (QNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQY), Synonym: FZD4, Application: IHC-P, WB, Size:100ug
Catalog Number: 76171-582
Supplier: Boster Biological Technology


Description: POLB/Dna Polymerase Beta Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: E.coli-derived human POLB recombinant protein, Synonyms: DNA polymerase beta, 2.7.7.7, 4.2.99.-, POLB, Size: 100ug/vial
Catalog Number: 76174-480
Supplier: Boster Biological Technology


Description: ITPR3/Ip3R3 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: synthetic peptide corresponding to a the N-terminus (70-95aa), Synonyms: Inositol 1,4,5-trisphosphate receptor type 3, Application: WB, size: 100ug/vial
Catalog Number: 76173-688
Supplier: Boster Biological Technology


Description: Estrogen Inducible Protein pS2 polyclonal antibody, Host: Rabbit, Species reactivity: Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of mouse Estrogen Inducible Protein pS2
Catalog Number: 10209-090
Supplier: Boster Biological Technology


Description: Haptoglobin polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Haptoglobin(294-309aa DHLKYVMLPVADQDQC)
Catalog Number: 10209-290
Supplier: Boster Biological Technology


Description: Tuberin Picoband* Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, isotype: IgG, E.coli-derived human Tuberin recombinant protein (Position: H1611-V1807). Human Tuberin shares 94% and 90% amino acid
Catalog Number: 10209-436
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human FSTL1, Immunogen: NSO, M1-I308, Assay range: 312pg/ml-20, 000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-650
Supplier: Boster Biological Technology


Description: P53 antibody, Monoclonal, Host: Mouse IgG, Clone number: IMD-53, Synonyms: LFS1/TRP53/Li-Fraumeni syndrome/TRANSFORMATION-RELATED PROTEIN 53/Antigen NY-CO-13/Phosphoprotein p53/Tumor suppressor p53, Reactivity: Human, Immunogen: Recombinant human wild-type p53 protein.
Catalog Number: 10206-196
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* elisa kit of Quantitative Detection for Mouse Gp130/IL6ST Immunogen: NSO, Q23-E617 Assay range: 125pg/ml-8000pg/ml Sensitivity: < 10 pg/ml, Sample Type: cell culture supernates, serum and plasma(heparin, EDTA, citrate), 96-well plate precoated
Catalog Number: 10209-896
Supplier: Boster Biological Technology


Description: ERK1 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ERK1(287-301aa KTKVAWAKLFPKSDS), identical to the related mouse and rat sequences, Application: Western Blot
Catalog Number: 10207-136
Supplier: Boster Biological Technology


Description: MAOB Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 448-484aa REILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLER, Synonyms: Amine oxidase [flavin-containing] B, 1.4.3.4, Monoamine oxidase type B, Size: 100ug/vial
Catalog Number: 76173-794
Supplier: Boster Biological Technology


Description: SCGB1A1/uteroglobin ELISA Kit, Reactivity: Mouse, Sample Type: cell culture supernatants, serum, plasma and urine, Sample Volume: 100ul per well, Sensitivity: <1pg/ml, Assay Range: 4.7-300pg/ml, Alternative Names: Uteroglobin/SCGB1A1, Blastokinin, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-438
Supplier: Boster Biological Technology


209 - 224 of 5,847