You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: GLUT4 Picoband* antibody, polyclonal, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human GLUT4 recombinant protein (Position: N333-D509). Human GLUT4 shares 97% amino acid (aa) sequence identity with mouse GLUT4.
Catalog Number: 10208-138
Supplier: Boster Biological Technology


Description: GDF5/Bmp 14 PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species: Rat, Assay: 31.2pg/ml, Sandwich High Sensitivity ELISA kit for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-612
Supplier: Boster Biological Technology


Description: Clusterin, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: E. Coli-derived human Apolipoprotein J recombinant protein, Synonyms: lusterin, Aging-associated gene 4 protein, Apolipoprotein, Application: WB, IHC-P, ELISA, Size: 100ug/vial
Catalog Number: 76174-006
Supplier: Boster Biological Technology


Description: Picoband*GABBR1/Gaba B Receptor 1 Polyclonal antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: E.coli-derived human GABBR1 recombinant protein, Synonym: Gamma-aminobutyric acid type B receptor subunit 1, Uses: WB, Size: 100ug/vial
Catalog Number: 76171-994
Supplier: Boster Biological Technology


Description: IL1 beta Picoband, Polyclonal Antibody, Host: Rabbit, Species: Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of mouse IL1 beta (DPKQYPKKKMEKRFVFNKIEVKSKVEFESAE), Synonym: Interleukin-1 beta, IL-1 beta, Il1b, Application: WB, Size:100ug
Catalog Number: 76170-792
Supplier: Boster Biological Technology


Description: Sandwich High Sensitivity ELISA kit for Quantitative Detection of human PSG1. 96wells/kit, with removable strips.
Catalog Number: 76466-866
Supplier: Boster Biological Technology


Description: CXCR1 Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CXCR1(24-38aa DEDYSPCMLETETLN), Application: Western Blot, IHC-P
Catalog Number: 10206-990
Supplier: Boster Biological Technology


Description: Optineurin Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E.coli-derived human Optineurin recombinant protein (R241-I577), Synonyms: Optineurin; E3-14.7K-interacting protein, Application: IHC-P, WB, size: 100ug/vial
Catalog Number: 76173-520
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for human BMP-4 Immunogen: NSO, S293-R408 Assay range: 62.5pg/ml-4000pg/ml Sensitivity: < 4 pg/ml 96-well plate precoated Sample Type: bone tissue and cell culture supernates.
Catalog Number: 10207-742
Supplier: Boster Biological Technology


Description: Niemann Pick C2 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence of human Niemann Pick C2, Alternative Names: Niemann-Pick type C2, EDDM1, Epididymal Protein 1, epididymal secretory protein E1, Size: 100ug/vial
Catalog Number: 76464-476
Supplier: Boster Biological Technology


Description: FGF19 EZ-Set* ELISA Kit (DIY Antibody Pairs), Species: Human, Sensitivity: <10pg/ml, Sample Type: cell culture supernates, cell lysates, tissue homogenates, serum and plasma (heparin, EDTA), Assay Range: 15.6pg/ml-1000pg/ml, Size: For 5 plates, 96 wells
Catalog Number: 76172-852
Supplier: Boster Biological Technology


Description: Pig Porcine CXCL14 PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), Species reactivity: Pig, Assay Range: 62.5pg/ml, Sandwich High Sensitivity, Immunogen: S35-E111, Size: 96wells/kit
Catalog Number: 76172-420
Supplier: Boster Biological Technology


Description: BnaA07g20720D Polyclonal Antibody, Host: Rabbit, Size: 200ul/vial
Catalog Number: 76466-324
Supplier: Boster Biological Technology


Description: MRP4 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Immunogen: E.coli-derived human MRP4 recombinant protein (Position: M1-K77, Synonym: Multidrug resistance-associated protein 4, Application: WB, Size:100ug
Catalog Number: 76171-474
Supplier: Boster Biological Technology


Description: Aryl hydrocarbon Receptor/Ahr Polyclonal Antibody, Host: Rabbit, Reactivity: Mouse, Rat, Immunogen: E.coli-derived rat Aryl hydrocarbon Receptor/Ahr recombinant protein (Position: R15-Q196), Alternative Names: Ahr, Ah receptor, AHR, AH-receptor, aryl hydrocarbon receptor, Size: 100ug/vial
Catalog Number: 76463-578
Supplier: Boster Biological Technology


Description: FABP4/A Fabp PicoKine* ELISA Kit, Sensitivity: <15pg/ml, Sample type: cell culture supernates, serum, plasma(heparin, EDTA) and cell lysates, Species: Rat, Assay: 156pg/ml, Sandwich High Sensitivity ELISA kit for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-734
Supplier: Boster Biological Technology


2,193 - 2,208 of 5,847