You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: Sandwich High Sensitivity ELISA kit for Quantitative Detection of mouse SLPI. 96wells/kit, with removable strips.
Catalog Number: 76466-864
Supplier: Boster Biological Technology


Description: Ly6al antibody, polyclonal, Host: Rabbit, Isotype: IgG, Species reactivity: Rat, Immunogen: A synthetic peptide corresponding to a sequence of rat Ly6al(91-108aa, TVVQVNTSCCTRDLCNAA).Application: WB
Catalog Number: 10208-044
Supplier: Boster Biological Technology


Description: PLN/Phospholamban Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: syntic peptide corresponding to a sequence at N-terminus (1-35aa), Synonyms: PLB; PLN, Application: WB, size: 100ug/vial
Catalog Number: 76173-596
Supplier: Boster Biological Technology


Description: Stefin B CSTB Monoclonal Antibody: Clone: 2B6), Host: Mouse, Reactivity: Human, Conjugate: DyLight* 488, Immunogen: E. Coli-derived human Stefin B recombinant protein (Position: M1-F98), Alternative Names: Cystatin B/Stefin B, CPI-B, Size: 50ug/vial
Catalog Number: 76467-876
Supplier: Boster Biological Technology


Description: Involucrin Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: 551-585aa QVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK, Synonyms: Involucrin, IVL, Application: WB, Purity: Immunogen affinity purified, Size: 100ug/vial
Catalog Number: 76174-240
Supplier: Boster Biological Technology


Description: SNAP23 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SNAP23(192-211aa DTNRDRIDIANARAKKLIDS).
Catalog Number: 10206-712
Supplier: Boster Biological Technology


Description: Cystatin B, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: E. Coli-derived human Stefin B recombinant protein, Synonyms: Cystatin-B, CPI-B, Liver thiol proteinase inhibitor, Application: WB, IHC-P, ELISA, Size: 100ug/vial
Catalog Number: 76173-988
Supplier: Boster Biological Technology


Description: IL-1RA ELISA Kit EZ-Set* (DIY Antibody Pairs), Sample Volume: 100ul per well, Reactivity: Human, Sensitivity: <2pg/ml, Assay Range: 31.2pg/ml-2000pg/ml, Immunogen: StandardExpression system : E.coli, R26-E177 Alternative Names: IL-1ra/IL-1F3/IL1RN, DIRA ICIL-1ra, Size: For 5 plates, 96 wells each
Catalog Number: 76467-216
Supplier: Boster Biological Technology


Catalog Number: 10207-588
Supplier: Boster Biological Technology


Description: WRN Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Rat, Immunogen: E. Coli-derived human WRN recombinant protein (Q122-N240), Synonyms: Werner syndrome ATP-dependent helicase; 3.6.4.12, Application: WB, size: 100ug/vial
Catalog Number: 76173-128
Supplier: Boster Biological Technology


Description: ULBP3 ELISA Kit, Sample Volume: 100ul per well, Reactivity: Human, Sensitivity: <50pg/ml, Assay Range: 62.5pg/ml-4000pg/ml, Immunogen: StandardExpression system for standard: NSO, sequence: D30-G217 Alternative Names: ULBP-3, NKG2D ligand 3, RAET1N, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-504
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human MIA, Immunogen: E.coli, G25-131Q, Assay range: 15.6pg/ml-1000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum, plasma(heparin, EDTA) and saliva, 96-well plate precoated
Catalog Number: 10205-858
Supplier: Boster Biological Technology


Description: CTBP1 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CtBP1(425-440aa QTVKPEADRDHASDQL), different from the related rat and mouse sequences by one amino acid
Catalog Number: 10206-856
Supplier: Boster Biological Technology


Description: ATF6 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ATF6 (597-629aa), Synonym: ATF6, Application: IHC-P, WB, Size:100ug
Catalog Number: 76171-122
Supplier: Boster Biological Technology


Description: TNFRSF25 antibody, polyclonal, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human DR3(73-94aa CPQDTFLAWENHHNSECARCQA).Application: WB
Catalog Number: 10208-846
Supplier: Boster Biological Technology


Description: MIP-1Alpha/CCL3 EZ-Set* ELISA Kit (DIY Antibody Pairs), Species: Rat, Sensitivity: <1pg/ml, Sample Type: cell culture supernates, serum and plasma(heparin, EDTA, citrate), Assay Range: 7.8pg/ml-500pg/ml, Size: For 5 plates, 96 wells
Catalog Number: 76172-856
Supplier: Boster Biological Technology


2,017 - 2,032 of 5,847