You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: Calretinin polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Calretinin(4-18aa PQQQPPYLHLAELTA), identical to the related rat sequence.
Catalog Number: 10209-342
Supplier: Boster Biological Technology


Description: Cytokeratin 14 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Cytokeratin 14 (446-472aa), Synonym: KRT14, Application: IHC-P, WB, Size:100ug
Catalog Number: 76171-438
Supplier: Boster Biological Technology


Description: Serpin A1/AAT ELISA Kit, Sample Volume: 100ul per well, Reactivity: Human, Sensitivity: <10pg/ml, Assay Range: 1.56ng/ml-100ng/ml, Immunogen: StandardExpression system for standard: NSO,E25-K418 Alternative Names: Serpin A1/alpha 1-Antitrypsin, A1A, A1AT, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-436
Supplier: Boster Biological Technology


Description: HGD Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: E. Coli-derived human HGD recombinant protein (Position: D374-N445), Alternative Names: HGD, AKU, EC 1.13.11.5, HGOFLJ94126, Applications: ELISA, Flow Cytometry, IF, IHC-P, ICC, WB, Size: 100ug/vial
Catalog Number: 76464-676
Supplier: Boster Biological Technology


Description: GCSF Receptor antibody, Polyclonal, Host: Rabbit IgG, Synonyms: CD 114 antibody/CD114 antibody, Reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human GCSF Receptor(254-271aa EPWQPGLHINQKCELRHK).
Catalog Number: 10206-340
Supplier: Boster Biological Technology


Description: FMO1 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 334-363aa AFPFLDESVVKVEDGQASLYKYIFPAHLQK, Synonyms: Fetal hepatic flavin-containing monooxygenase 1, FMO 1, FMO1, Application: WB, Size: 100ug/vial
Catalog Number: 76174-034
Supplier: Boster Biological Technology


Description: IL2RB/Il 2Rbeta Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Mouse, Isotype: IgG, Immunogen: 503-539aa NLHGQDQDRGQGPILTLNTDAYLSLQELQAQDSVHLI, Synonyms: IL-2R subunit beta, IL-2RB, CD122, Il2rb, Application: WB, Size: 100ug/vial
Catalog Number: 76174-338
Supplier: Boster Biological Technology


Description: Beta Catenin polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human beta Catenin(764-781aa DGLPPGDSNQLAWFDTDL)
Catalog Number: 10209-232
Supplier: Boster Biological Technology


Description: Tec antibody, polyclonal, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Tec(612-631aa FEDLLRTIDELVECEETFGR), identical to the related rat sequence
Catalog Number: 10208-844
Supplier: Boster Biological Technology


Description: ABCA4 polyclonal antibody, Host: Rabbit, Species reactivity: Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse ABCA4(1892-1903aa TLLIQHHFFLTR), identical to the related rat sequence.
Catalog Number: 10209-656
Supplier: Boster Biological Technology


Description: PTEN Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Rat, Immunogen: E.coli-derived human PTEN recombinant protein (E91-V403), Synonyms: Phosphatase and tensin homolog; PTEN; MMAC1, TEP1, Application: WB, size: 100ug/vial
Catalog Number: 76173-604
Supplier: Boster Biological Technology


Description: CD62L polyclonal antibody, Host: Rabbit, Species reactivity: Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of mouse CD62L(125-141aa KEDCVEIYIKRERDSGK), identical to the related rat sequence.
Catalog Number: 10209-552
Supplier: Boster Biological Technology


Description: Human Kallikrein-6 Picokine Elisa Kit, Sample type: cell culture supernates, cell lysates, serum, plasma(heparin, EDTA) and tissue homogenates, 96-well plate precoated
Catalog Number: 10207-596
Supplier: Boster Biological Technology


Description: CD147/Emmprin Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: E.coli-derived human CD147/Emmprin recombinant protein (Position: E138-A323, Synonym: BSG, Application: ELISA, Flow Cytometry, IHC-P, IHC-F, ICC, WB, Size:100ug
Catalog Number: 76170-922
Supplier: Boster Biological Technology


Description: TPA Tissue Plasminogen Activator Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence of PLAT, Alternative Names: t-Plasminogen Activator/tPA, Alteplase, DKFZp686I03148, EC 3.4.21, Size: 100ug/vial
Catalog Number: 76465-068
Supplier: Boster Biological Technology


Description: TNFRSF7/CD27 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: E. Coli-derived human CD27 recombinant protein, Synonyms: CD27 antigen, CD27L receptor, Application: WB, IHC-P, IHC-F, ICC, Size: 100ug/vial
Catalog Number: 76174-700
Supplier: Boster Biological Technology


2,001 - 2,016 of 5,847