You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: IGFBP2 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: E. Coli-derived human IGFBP2 recombinant protein (Position: A36-Q325), Synonym: IGFBP2, BP2, IBP2, Application: ELISA, IHC-P, WB, Size:100ug
Catalog Number: 76171-412
Supplier: Boster Biological Technology


Description: Caspase-3(P10) Polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Caspase-3(P10)(220-236aa CAMLKQYADKLEFMHIL).
Catalog Number: 10209-542
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for human Prolactin Immunogen: E.coli, L29-C227 Assay range: 156pg/ml-10, 000pg/ml Sensitivity: < 10 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum and plasma(heparin, citrate).
Catalog Number: 10207-660
Supplier: Boster Biological Technology


Description: EGFR PicoKine* ELISA Kit, Sensitivity: <15pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species reactivity: Mouse, Assay: 156pg/ml, Sandwich High Sensitivity ELISA kit for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-336
Supplier: Boster Biological Technology


Description: PPM1D/WIP1 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived PPM1D/WIP1 recombinant protein (Position: R18-C605), Alternative Names: PPM1D, EC 3.1.3.16, p53-induced protein phosphatase 1, PP2C-delta, PPM1D, Application: WB, Size: 100ug/vial
Catalog Number: 76464-468
Supplier: Boster Biological Technology


Description: Cdc37 antibody, Polyclonal, Host: Rabbit, Reactivity: Human, Rabbit IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Cdc37, Application: WB.
Catalog Number: 10209-994
Supplier: Boster Biological Technology


Description: FABP3 ELISA Kit EZ-Set* (DIY Antibody Pairs), Sample Volume: 100ul per well, Reactivity: Rat, Sensitivity: <10pg/ml, Assay Range: 93.7pg/ml-6000pg/ml, Immunogen: StandardExpression system for standard: E.coli,A2-A133 Alternative Names: FABP3/H-FABP, FABP11 FABP3, Size: For 5 plates, 96 wells each
Catalog Number: 76467-294
Supplier: Boster Biological Technology


Description: Integrin beta 5 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Isotype: IgG, Immunogen: E.coli-derived Integrin beta 5/ITGB5 recombinant protein, Position: S32-D689, Alternative Names: Integrin beta 5, FLJ26658, Integrin beta 5, integrin beta-5, integrin, beta 5, Size: 100ug/vial
Catalog Number: 76465-326
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Mouse Sclerostin/SOST, Immunogen: NSO, Q24-Y211, Assay range: 15.6pg/ml-1000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-200
Supplier: Boster Biological Technology


Description: R-Cadherin-4 Cdh4 ELISA Kit, Reactivity: Mouse, Sample Type: cell culture supernatants, serum and plasma, Sample Volume: 100ul per well, Sensitivity: <50pg/ml, Assay Range: 156-10000pg/ml, Alternative Names: Cadherin-4/R-Cadherin, CAD4, Size: 96wells/kit, with removable strips.
Catalog Number: 76467-054
Supplier: Boster Biological Technology


Description: Cathepsin G Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Mouse, Isotype: IgG, Immunogen: E.coli-derived mouse Cathepsin G recombinant protein, Synonyms: Cathepsin G, 3.4.21.20, Vimentin-specific protease, VSP, Ctsg, Size: 100ug/vial
Catalog Number: 76174-566
Supplier: Boster Biological Technology


Description: LFA3 Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Isotype: IgG, Immunogen: E. Coli-derived human LFA3 recombinant protein, Synonym: Lymphocyte function-associated antigen 3, Application: Western blot, IHC-P, IHC-F, ICC, FCM, Size: 100ug/vial
Catalog Number: 76174-800
Supplier: Boster Biological Technology


Description: BMP-10 ELISA Kit, Sample Volume: 100ul per well, Reactivity: Rat, Sensitivity: <10pg/ml, Assay Range: 15.6pg/ml-1000pg/ml, Immunogen: StandardExpression system for standard: NSO, sequence: N314-R421 Alternative Names: BMP-10, BMP10, BMP-10, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-622
Supplier: Boster Biological Technology


Description: CCL21/6Ckine PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species: Mouse, Assay: 15.6pg/ml, Sandwich High Sensitivity for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-166
Supplier: Boster Biological Technology


Description: Gremlin 1 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Rat, Isotype: IgG, Immunogen: 151-184aa TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD, Synonyms: Gremlin-1, Cell proliferation-inducing gene 2 protein, Application: WB, Size: 100ug/vial
Catalog Number: 76174-108
Supplier: Boster Biological Technology


Description: SOD2/Mnsod Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: synthetic peptide corresponding to a sequence at the C-terminus (192-222aa), Synonyms: Superoxide dismutase [Mn], Application: WB, size: 100ug/vial
Catalog Number: 76173-716
Supplier: Boster Biological Technology


1,825 - 1,840 of 5,847