You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: Kininogen-1/KNG1 Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E.coli-derived human Kininogen 1 recombinant protein (Q19-N210), Synonyms: Kininogen-1, KNG1; BDK, KNG, Application: Western Blot, size: 100ug/vial
Catalog Number: 76173-390
Supplier: Boster Biological Technology


Description: Endostatin PicoKine* ELISA Kit, Sensitivity: <15pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species: Rat, Assay: 156pg/ml, Sandwich High Sensitivity ELISA kit for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-468
Supplier: Boster Biological Technology


Description: Picoband*Epigen Polyclonal antibody, Host: Rabbit, Species reactivity: Human, Rat, Immunogen: E. Coli-derived human Epigen recombinant protein, Synonyms: Epigen, Epithelial mitogen, EPG, EPGN, Application: WB, Storage: -20 to 4 deg C, Size: 100ug/vial
Catalog Number: 76172-042
Supplier: Boster Biological Technology


Description: MMP-12 Polyclonal Antibody, Host: Rabbit, Reactivity: Mouse, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP12 (432-466aa), Synonym: Macrophage metalloelastase, Application: WB, ELISA, Size: 100 ug/vial
Catalog Number: 76174-966
Supplier: Boster Biological Technology


Description: Cdc6 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Rat, Isotype: IgG, Immunogen: E.coli-derived human Cdc6 recombinant protein, Synonyms: HsCdc18, p62(cdc6), HsCDC6, CDC6, CDC18L, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76173-928
Supplier: Boster Biological Technology


Description: Glutamate receptor 3 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Glutamate receptor 3(394-412aa RKAGYWNEYERFVPFSDQQ)
Catalog Number: 10209-134
Supplier: Boster Biological Technology


Description: CtBP1 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: synthetic peptide corresponding to a sequence at the C-terminus (409-440aa), Synonyms: CtBP1; 1.1.1.-; CTBP1; CTBP, Application: WB, size: 100ug/vial
Catalog Number: 76173-682
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Mouse TSLP, Immunogen: NSO, Y20-E140, Assay range: 15.6pg/ml-1000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-782
Supplier: Boster Biological Technology


Description: ADAM17 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ADAM17(806-824aa AASFKLQRQNRVDSKETEC).
Catalog Number: 10206-722
Supplier: Boster Biological Technology


Description: GJB2 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human GJB2(1-16aa, MDWGTLQTILGGVNKH), different from the related mouse and rat sequences by two amino acids.
Catalog Number: 10209-730
Supplier: Boster Biological Technology


Description: Annexin VIII polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Annexin VIII(445-460aa TRSEIDLVQIKQMFAQ)
Catalog Number: 10209-266
Supplier: Boster Biological Technology


Description: MLH1 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 722-756aa KALRSHILPPKHFTEDGNILQLANLPDLYKVFERC, Synonyms: DNA mismatch repair protein Mlh1, MutL protein homolog 1, Application: WB, Size: 100ug/vial
Catalog Number: 76174-264
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for mouse SCF Immunogen: E.coli, K26-A190 Assay range: 31.2pg/ml-2000pg/ml Sensitivity: < 10 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum and plasma(EDTA).
Catalog Number: 10207-896
Supplier: Boster Biological Technology


Description: Cy3 conjugated goat rabbit IgG secondary antibody . Application: IHC-P, IHC-F, ICC. Pack Size: 0.5mg
Catalog Number: 10208-940
Supplier: Boster Biological Technology


Description: CD3 epsilon Picoband* Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, isotype: IgG, E.coli-derived human CD3 epsilon recombinant protein (Position: D23-I207), Human CD3 epsilon shares 65% amino acid
Catalog Number: 10209-316
Supplier: Boster Biological Technology


Description: GDF-15 Quick ELISA Kit, Reactivity: Human, Sample Type: cell culture supernatants, cell lysates, serum and plasma (heparin, EDTA), Sample Volume: 100ul per well, Sensitivity: <10pg/ml, Assay Range: 31.2pg/ml-2000pg/ml, Alternative Names: GDF-15, GDF15, Size: 96wells/kit, with removable strips.
Catalog Number: 76467-392
Supplier: Boster Biological Technology


1,777 - 1,792 of 5,847