You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Mouse Endothelin, Assay range: 3.9pg/ml-250pg/ml, Sensitivity: < 0.5 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-412
Supplier: Boster Biological Technology


Description: Hsp105 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp105(713-733aa EVMEWMNNVMNAQAKKSLDQD).
Catalog Number: 10206-702
Supplier: Boster Biological Technology


Description: Neuroserpin Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 272-310aa KAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKA L, Synonyms: Neuroserpin, Peptidase inhibitor 12, PI-12, Application: WB, Size: 100ug/vial
Catalog Number: 76174-304
Supplier: Boster Biological Technology


Description: LBP Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Mouse, Rat, Immunogen: E. Coli-derived mouse LBP recombinant protein (Position: V26-R257), Synonym: Lipopolysaccharide-binding protein, LBP, Lbp, Application: ELISA, WB, Size:100ug
Catalog Number: 76171-178
Supplier: Boster Biological Technology


Description: E2F4 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human E2F4(228-243aa LPKPALAQSQEASRPN), different from the related mouse and rat sequences by four amino acids.
Catalog Number: 10209-806
Supplier: Boster Biological Technology


Description: Perilipin A PLIN1 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Conjugate: DyLight* 550, Immunogen: A synthetic peptide corresponding to a sequence of Perilipin A, Alternative Names: Perilipin, PERI, perilipin 1, Perilipin, perilipin-1, Size: 50ug/vial
Catalog Number: 76465-266
Supplier: Boster Biological Technology


Description: IDE Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Conjugate: DyLight* 488, Immunogen: E. Coli-derived human IDE recombinant protein (Position: F485-K756), Alternative Names: Insulysin/IDE, Abeta-degrading protease, EC 3.4.24, EC 3.4.24.56, FLJ35968, Size: 50ug/vial
Catalog Number: 76464-316
Supplier: Boster Biological Technology


Description: Lamin A+C polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Lamin A+C(455-469aa RNKSNEDQSMGNWQI), identical to the related rat and mouse sequences.
Catalog Number: 10209-414
Supplier: Boster Biological Technology


Description: PKM2 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: synthetic peptide corresponding to a sequence at the N-terminus of human PKM2(475-500aa), Synonyms: Pyruvate kinase PKM; 2.7.1.40, Application: IHC-P, WB, size: 100ug/vial
Catalog Number: 76173-592
Supplier: Boster Biological Technology


Description: Monoamine Oxidase B polyclonal antibody, Host: Rabbit, Species reactivity: Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of mouse Monoamine Oxidase B(42-56aa RTYTIRNKNVKYVDL)
Catalog Number: 10209-144
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Rat IL-10, Immunogen: E.coli, S19-N178, Assay range: 31.2pg/ml-2000pg/ml, Sensitivity: < 4 pg/ml, Sample type: cell culture supernates, serum and plasma(EDTA), 96-well plate precoated
Catalog Number: 10205-828
Supplier: Boster Biological Technology


Description: VEGF/Vegfa Polyclonal Antibody, Host: Rabbit, Reactivity: Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived mouse VEGF/Vegfa recombinant protein (Position: E38-R214), Alternative Names: Vegfa, MVCD1, VAS, VEGF, VEGFA, Applications: ELISA, WB, Size: 100ug/vial
Catalog Number: 76463-462
Supplier: Boster Biological Technology


Description: C5/C5a polyclonal antibody, Host: Rabbit, Species reactivity: Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of rat C5a(1-18aa DLQLLHQKVEEQAAKYKH), different from the related mouse sequence by four amino acids.
Catalog Number: 10209-502
Supplier: Boster Biological Technology


Description: IL-10 ELISA Kit EZ-Set* (DIY Antibody Pairs), Sample Volume: 100ul per well, Reactivity: Human, Sensitivity: <0.5pg/ml, Assay Range: 7.8pg/ml-500pg/ml(cell culture)3.4pg/ml-250pg/ml(human serum, plasma) Alternative Names: IL-10, CSIF, Size: For 5 plates, 96 wells each
Catalog Number: 76467-152
Supplier: Boster Biological Technology


Description: ALIX Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived human ALIX recombinant protein, Synonyms: Programmed cell death 6-interacting protein, ALIX, KIAA137, Application: WB, Size: 100ug/vial
Catalog Number: 76174-356
Supplier: Boster Biological Technology


Description: SERPINA5/Protein C Inhibitor Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: E.coli-derived human SERPINA5 recombinant protein (Position: S86-P406, Synonym: PROCI, Application: IHC-P, WB, Size:100ug
Catalog Number: 76171-532
Supplier: Boster Biological Technology


1,745 - 1,760 of 5,847