You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: GAD65 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human GAD65(21-37aa ENPGTARAWCQVAQKFT), identical to the related mouse and rat sequences, Application:, IHC-P
Catalog Number: 10206-818
Supplier: Boster Biological Technology


Description: Interferon gamma Ifng Monoclonal Antibody, Clone: 8E9, Host: Mouse, Reactivity: Rat, Immunogen: E. Coli-derived rat Interferon gamma recombinant protein (Position: Q23-C156). Rat Interferon gamma shares 38% and 86% amino acid (aa) sequence, Alternative Names: IFG, Size: 100ug/vial
Catalog Number: 76467-600
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for mouse FGF1 Immunogen: E.coli, F16-D155 Assay range: 31.2pg/ml-2000pg/ml Sensitivity: < 10 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum and plasma(heparin, EDTA).
Catalog Number: 10209-054
Supplier: Boster Biological Technology


Description: FGF2 ELISA Kit, Sample Volume: 100ul per well, Reactivity: Human, Sensitivity: <10pg/ml, Assay Range: 62.5pg/ml-4000pg/ml, Alternative Names: FGF basic/FGF2/bFGF, basic fibroblast growth factor bFGF, Basic fibroblast growth factor, bFGF, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-348
Supplier: Boster Biological Technology


Description: HDGF Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HDGF (61-97aa), Synonym: HMG-1L2, HDGF, HMG1L2, Application: IHC-P, WB, Size:100ug
Catalog Number: 76171-284
Supplier: Boster Biological Technology


Description: Ku80 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 649-676 aa FSEEQRFNNFLKALQEKVEIKQLNHFWE, Synonyms: X-ray repair cross-complementing protein 5, 3.6.4, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76173-750
Supplier: Boster Biological Technology


Description: HE4 PicoKine* ELISA Kit, Sensitivity: <15pg/ml, Sample type: cell culture supernates, serum, plasma(heparin, EDTA), saliva, urine and human milk, Species: Human, Assay: 156pg/ml, Sandwich High Sensitivity ELISA kit for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-570
Supplier: Boster Biological Technology


Description: NFkB p105/p50 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human NFkB p105(193-208aa KELIRQAALQQTKEMD)
Catalog Number: 10209-216
Supplier: Boster Biological Technology


Description: PIAS4 Antibody, polyclonal, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Isotype:IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human E3 SUMO-protein ligase PIAS4(295-310aa HPELCKALVKEKLRLD), for E3 SUMO-protein ligase detection.
Catalog Number: 10205-914
Supplier: Boster Biological Technology


Description: FCRN/FCGRT Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Mouse, Isotype: IgG, Immunogen: E. Coli-derived mouse FCGRT recombinant protein, Synonyms: IgG receptor FcRn large subunit p51, Fc receptor, Fcgrt, Fcrn, Size: 100ug/vial
Catalog Number: 76174-398
Supplier: Boster Biological Technology


Description: CD80 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of rat CD80(227-245aa DAHVSQNFTWEKPPEDPPD), different from the related mouse sequence by two amino acids
Catalog Number: 10207-150
Supplier: Boster Biological Technology


Description: PAK1 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PAK1(1-14aa MSNNGLDIQDKPPA), different from the related mouse and rat sequences by on amino acid.
Catalog Number: 10209-764
Supplier: Boster Biological Technology


Description: CCKBR Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Conjugate: DyLight* 488, Immunogen: A synthetic peptide corresponding to a sequence of CCKBR, Alternative Names: Cholecystokinin-B R/CCKBR, CCK2 receptor, CCK2R, CCK2-R, CCK-B receptor, Size: 50ug/vial
Catalog Number: 76464-546
Supplier: Boster Biological Technology


Description: Fetuin B PicoKine* ELISA Kit, Sensitivity: <12pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species: Human, Assay: 62.5pg/ml, Sandwich High Sensitivity ELISA kit for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-600
Supplier: Boster Biological Technology


Description: NOPE/IGDCC4 PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species: Mouse, Assay: 125pg/ml, Sandwich High Sensitivity for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-648
Supplier: Boster Biological Technology


Description: NKG2D Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human NKG2D (YQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYH), Synonym: CD314, KLRK1, D12S2489E, NKG2D, Size:100ug
Catalog Number: 76171-124
Supplier: Boster Biological Technology


161 - 176 of 5,847