You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: AQP11/Aquaporin 11 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: syntic peptide corresponding to a sequence at N-terminus (35-70aa), Synonyms: Aquaporin-11; AQP-11, Application: WB, size: 100ug/vial
Catalog Number: 76173-002
Supplier: Boster Biological Technology


Description: RANK/TNFRSF11A Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Rat, Isotype: IgG, Immunogen: E. Coli-derived human RANK recombinant protein (Position: C34-L211), Alternative Names: RANK/TNFRSF11A, CD265 antigen, CD265, FEO, Applications: ELISA, WB, Size: 100ug/vial
Catalog Number: 76464-118
Supplier: Boster Biological Technology


Description: IDH1 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 381-413aa KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK, Synonyms: NADP(+)-specific ICDH, Oxalosuccinate decarboxylase, IDH1, PICD, Size: 100ug/vial
Catalog Number: 76174-058
Supplier: Boster Biological Technology


Description: CANT1 ELISA Kit, Sample Volume: 100ul per well, Reactivity: Human, Sensitivity: <50pg/ml, Assay Range: 156pg/ml-10000pg/ml, Alternative Names: Calcium Activated Nucleotidase 1/CANT1, Apyrase homolog, calcium activated nucleotidase 1, CANT1, Size: 96wells/kit, with removable strips.
Catalog Number: 76467-082
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human TIMP-1, Immunogen: NSO, C24-A207, Assay range: 156pg/ml-10, 000pg/ml, Sensitivity: < 5 pg/ml, Sample type: cell culture supernates, serum, plasma(heparin, EDTA) and saliva, 96-well plate precoated
Catalog Number: 10205-616
Supplier: Boster Biological Technology


Description: RAGE Picoband* Antibody, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 91-120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI, Synonyms: specific receptoR, Application: Western Blot, IHC-P, Size: 100ug/vial
Catalog Number: 76173-760
Supplier: Boster Biological Technology


Description: Keratocan Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Isotype: IgG, Immunogen: 77-109aa YLQNNLIETIPEKPFENATQLRWINLNKNKITN, Synonyms: Keratocan, KTN, Keratan sulfate proteoglycan keratocan, Application: WB, Size: 100ug/vial
Catalog Number: 76174-162
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for mouse IL-10 Immunogen: E.coli, S19-S178 Assay range: 15.6pg/ml-1000pg/ml Sensitivity: < 1 pg/ml 96-well plate precoated Sample Type: cell culture supernates and serum.
Catalog Number: 10207-758
Supplier: Boster Biological Technology


Description: SEMA4G ELISA Kit, Sample Volume: 100ul per well, Reactivity: Human, Sensitivity: <10pg/ml, Assay Range: 15.6pg/ml-1000pg/ml, Immunogen: StandardExpression system : NSO, sequence: V18-L675, Alternative Name: Semaphorin 4G, KIAA1619FLJ20590, MGC102867, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-882
Supplier: Boster Biological Technology


Description: COX2/Cyclooxygenase 2 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human COX2(589-604aa DDINPTVLLKERSTEL). Application: IHC-P, IHC-F, WB
Catalog Number: 10206-054
Supplier: Boster Biological Technology


Description: Integrin alpha 1 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Integrin alpha 1(1121-1134aa SNQKRELAIQISKD).
Catalog Number: 10206-208
Supplier: Boster Biological Technology


Description: TBR2/Eomes Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: E. Coli-derived human TBR2/Eomes recombinant protein, Position: T310-D532, Alternative Names: EOMES, EOMES, eomesodermin (Xenopus laevis) homolog, Eomesodermin, Size: 100ug/vial
Catalog Number: 76464-054
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for human IL-6R alpha Immunogen: sf21, L20-D358 Range: 31.2pg/ml -2000pg/ml Sensitivity: > 10 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum, plasma(heparin, EDTA, citrate) and urine.
Catalog Number: 10208-804
Supplier: Boster Biological Technology


Description: EIF2S2 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human EIF2S2(199-214aa FQAVTGKRAQLRAKAN), identical to the related mouse and rat sequences.
Catalog Number: 10206-752
Supplier: Boster Biological Technology


Description: Tau antibody, Monoclonal, Host: Mouse IgG, Clone number: TAU-93, Synonyms: DDPAC/MAPTL/PHF-tau/FLJ31424/FTDP-17/MGC138549/MSTD/MTBT1/MTBT2/PPND/TAU/G protein beta1, Reactivity: Bovine, Human, Immunogen: Bovine microtubule-associated proteins(MAPs). Application: IHC-P, WB
Catalog Number: 10206-200
Supplier: Boster Biological Technology


Description: ERp57 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 471-505aa RELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL, Synonyms: Protein disulfide-isomerase A3, 5.3.4.1, Application: WB, IHC-P, IHC-F, Size: 100ug/vial
Catalog Number: 76174-360
Supplier: Boster Biological Technology


1,729 - 1,744 of 5,847