You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: Chinese Hamster BMP-7 PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: bone tissue, cell culture supernates, serum and plasma(heparin, EDTA), Species reactivity: Hamster, Assay: 31.2pg/ml, Sandwich High Sensitivity, Size: 96wells/kit
Catalog Number: 76172-534
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Mouse VEGFR3/FLT4 Immunogen: NSO, Y25-D770 Assay range: 156pg/ml-10, 000pg/ml Sensitivity: < 10 pg/ml, Sample Type: cell culture supernates and serum, 96-well plate precoated
Catalog Number: 10209-892
Supplier: Boster Biological Technology


Description: IL11 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Mouse, Rat, Immunogen: E. Coli-derived rat IL11 recombinant protein (Position: P25-L199), Synonym: Interleukin-11, IL-11, Il11, Application: ELISA, WB, Size:100ug
Catalog Number: 76171-348
Supplier: Boster Biological Technology


Description: Chicken TGF-Beta 2 PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA, citrate), Species reactivity: Chicken, Assay Range: 31.2pg/ml, Sandwich High Sensitivity, Size: 96wells/kit
Catalog Number: 76172-290
Supplier: Boster Biological Technology


Description: LASP1 antibody, Polyclonal, Host: Rabbit, Reactivity: Human, Mouse, RatRabbit IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human LASP1, Application: IHC-P, ICC, WB.
Catalog Number: 10209-966
Supplier: Boster Biological Technology


Description: IL17RA/Il 17R, Polyclonal Antibody, Host: Rabbit, Species: Human, Immunogen: E. Coli-derived human IL17RA recombinant protein Position: K53-Q284, Synonym: Interleukin-17 receptor A, IL-17 receptor A, IL-17RA, CDw217, CD217, IL17RA, Application: ELISA, WB, Size:100ug
Catalog Number: 76171-404
Supplier: Boster Biological Technology


Description: VEGF Receptor 1 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of rat VEGF Receptor 1(278-298aa IRQRIDQSNPHSNVFHSVLKI). Application: WB
Catalog Number: 10206-284
Supplier: Boster Biological Technology


Description: IBSP/Bone Sialoprotein Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: corresponding to a sequence of human IBSP (FSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAYFYPHLKRFPVQ), Synonym: IBSP, Application: WB, Size:100ug
Catalog Number: 76171-720
Supplier: Boster Biological Technology


Description: KLK12/Klk L5 PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma(heparin, EDTA), Species: Human, Assay: 156pg/ml, Sandwich High Sensitivity for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-386
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for human IL-33 Immunogen: E.coli, S112-T270 Assay range: 15.6pg/ml-1000pg/ml Sensitivity: < 10 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum, plasma(heparin, EDTA) and cell lysates.
Catalog Number: 10207-848
Supplier: Boster Biological Technology


Description: HLA-C Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: synthetic peptide corresponding to a sequence at the C-terminus (38-62aa), Synonyms: MHC class I antigen ; HLA-C, Application: WB, size: 100ug/vial
Catalog Number: 76173-588
Supplier: Boster Biological Technology


Description: VEGF Receptor 2 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human VEGF Receptor 2(454-469aa HHIHWYWQLEEECANE). Application: IHC-P, IHC-F, ICC, WB
Catalog Number: 10206-290
Supplier: Boster Biological Technology


Description: Resistin antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Mouse, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse Resistin(93-114aa CHCQCARIDWTAARCCKLQVAS). Application: IHC-P, WB
Catalog Number: 10206-550
Supplier: Boster Biological Technology


Description: DCK Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: E. Coli-derived human DCK recombinant protein (Position: E17-L260), Synonym: Deoxycytidine kinase, dCK, DCK, Application: ELISA, WB, Size:100ug
Catalog Number: 76170-896
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human GDNF, Immunogen: NSO, R109-I211, Assay range: 31.2pg/ml-2000pg/ml, Sensitivity: < 4 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-714
Supplier: Boster Biological Technology


Description: CTGF/Ccn2 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Rat, Isotype: IgG, Immunogen: E.coli-derived human CTGF recombinant protein, Synonyms: GF-binding protein 8, IGFBP-8, CTGF, CCN2, HCS24, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76173-948
Supplier: Boster Biological Technology


1,665 - 1,680 of 5,847