You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,846  results were found

SearchResultCount:"5846"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (10207-284)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for Tissue factor pathway inhibitor(TFPI) detection. Tested with WB, IHC-P in Human.


Catalog Number: (76171-170)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for Fibrinogen gamma chain(FGG) detection. Tested with WB, IHC-P in Human;Mouse;Rat.


Catalog Number: (76463-998)
Supplier: Boster Biological Technology
Description: SUR1 ABCC8 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Conjugate: DyLight* 550, Immunogen: synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQ RSECQLFEHWKTLMNRQDQELEKETVTERKA Alternative Names: SUR1, ABC36, Application: Flow Cytometry, Size: 50ug/vial


Catalog Number: (76464-976)
Supplier: Boster Biological Technology
Description: ACTN3 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Conjugate: DyLight* 488, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa), different from the related mouse sequence Alternative Names: actinin, Size: 50ug/vial


Catalog Number: (10206-590)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for Ribosomal protein S6 kinase alpha-1(RPS6KA1) detection. Tested with WB in Human;Mouse;Rat.


Catalog Number: (10208-948)
Supplier: Boster Biological Technology
Description: FITC conjugated rabbit rat IgG secondary antibody. Application: FCM, IHC-P, IHC-F, ICC. Pack Size: 0.5mg


Catalog Number: (10205-178)
Supplier: Boster Biological Technology
Description: Sandwich ELISA kit of Quantitative Detection for Human Amphiregulin(AR)


Catalog Number: (76464-594)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for Protein C detection. Tested with WB, Direct ELISA in Human;Mouse;Rat.


Catalog Number: (76467-238)
Supplier: Boster Biological Technology
Description: A ELISA kit containing the core components for developing solid phase sandwich ELISA assay to quantitatively detects CD23/FCER2 in Mouse samples. The kit contains antibody pairs, recombinant protein standards and HRP conjugated ABC.


Catalog Number: (10209-380)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for ATP-binding cassette sub-family G member 2(ABCG2) detection. Tested with WB in Mouse;Rat.


Catalog Number: (76174-032)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for Fms-related tyrosine kinase 3 ligand(FLT3LG) detection. Tested with WB in Human;Rat.


Catalog Number: (10205-676)
Supplier: Boster Biological Technology
Description: Sandwich ELISA kit of Quantitative Detection for Rat Lumican


Catalog Number: (10207-578)
Supplier: Boster Biological Technology
Description: Unconjugated Human IgG secondary antibody, Application: ELISA, IF, IHC-P, IHC-F, ICC, WesternBlot, Pack size: 5mg


Catalog Number: (76171-094)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for IL23 Receptor detection. Tested with WB, ELISA(Cap) in Mouse;Rat.


Catalog Number: (10208-910)
Supplier: Boster Biological Technology
Description: Cy3 conjugated rabbit Human IgG secondary antibody. Application: IHC-P, IHC-F, ICC. Pack Size: 0.5mg


Catalog Number: (10209-716)
Supplier: Boster Biological Technology
Description: Polyclonal antibody for Integrin beta 1/ITGB1 detection. Host: Rabbit.Size: 100μg/vial. Tested applications: IHC-P. Reactive species: Human. Integrin beta 1/ITGB1 information: Molecular Weight: 88415 MW; Subcellular Localization: Cell membrane ; Single-pass type I membrane protein . Cell projection, invadopodium membrane ; Single-pass type I membrane protein . Cell projection, ruffle membrane ; Single- pass type I membrane protein . Recycling endosome. Melanosome. Cleavage furrow. Cell projection, lamellipodium. Cell projection, ruffle. Isoform 2 does not localize to focal adhesions. Highly enriched in stage I melanosomes. Located on plasma membrane of neuroblastoma NMB7 cells. In a lung cancer cell line, in prometaphase and metaphase, localizes diffusely at the membrane and in a few intracellular vesicles. In early telophase, detected mainly on the matrix-facing side of the cells. By mid- telophase, concentrated to the ingressing cleavage furrow, mainly to the basal side of the furrow. In late telophase, concentrated to the extending protrusions formed at the opposite ends of the spreading daughter cells, in vesicles at the base of the lamellipodia formed by the separating daughter cells. Colocalizes with ITGB1BP1 and metastatic suppressor protein NME2 at the edge or peripheral ruffles and lamellipodia during the early stages of cell spreading on fibronectin or collagen. Translocates from peripheral focal adhesions sites to fibrillar adhesions in a ITGB1BP1-dependent manner. Enriched preferentially at invadopodia, cell membrane protrusions that correspond to sites of cell invasion, in a collagen-dependent manner. Localized at plasma and ruffle membranes in a collagen-independent manner; Tissue Specificity: Isoform 1 is widely expressed, other isoforms are generally coexpressed with a more restricted distribution. Isoform 2 is expressed in skin, liver, skeletal muscle, cardiac muscle, placenta, umbilical vein endothelial cells, neuroblastoma cells, lymphoma cells, hepatoma cells and astrocytoma cells. Isoform 3 and isoform 4 are expressed in muscle, kidney, liver, placenta, cervical epithelium, umbilical vein endothelial cells, fibroblast cells, embryonal kidney cells, platelets and several blood cell lines. Isoform 4, rather than isoform 3, is selectively expressed in peripheral T-cells. Isoform 3 is expressed in non- proliferating and differentiated prostate gland epithelial cells and in platelets, on the surface of erythroleukemia cells and in various hematopoietic cell lines. Isoform 5 is expressed specifically in striated muscle (skeletal and cardiac muscle).


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,649 - 1,664 of 5,846
no targeter for Bottom