You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: SIDT1 polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SIDT1(36-52aa RRDPFDAARGADFDHVY)
Catalog Number: 10209-660
Supplier: Boster Biological Technology


Description: PON1/Paraoxonase 1 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Mouse, Immunogen: E. Coli-derived mouse PON1 recombinant protein (Position: A30-D274), Synonym: Serum paraoxonase/arylesterase 1, PON 1, 3.1.1.2, Application: IHC-P, WB, Size:100ug
Catalog Number: 76170-870
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for human OPN Immunogen: NSO, I17-N300 Assay range: 156pg/ml-10, 000pg/ml Sensitivity: < 10 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum, plasma(heparin, EDTA), human milk and urine.
Catalog Number: 10207-892
Supplier: Boster Biological Technology


Description: EGF ELISA Kit EZ-Set* (DIY Antibody Pairs), Sample Volume: 100ul per well, Reactivity: Rat, Sensitivity: <1pg/ml, Assay Range: 7.8pg/ml-500pg/ml, Immunogen: StandardExpression system for standard: E.coli, N974-R1026 Alternative Names: Egf, beta-urogastrone, EGF, Size: For 5 plates, 96 wells each
Catalog Number: 76467-244
Supplier: Boster Biological Technology


Description: Furin Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E.coli-derived human Furin recombinant protein (T591-L794), Synonyms: Furin; 3.4.21.75, FURIN; FUR, PACE, PCSK3, Application: Western Blot, size: 100ug/vial
Catalog Number: 76173-232
Supplier: Boster Biological Technology


Description: TNFRSF18/Gitr Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: E. Coli-derived human TNFRSF18 recombinant protein (Position: L178-V241), Synonym: TNFRSF18, AITR, GITR, UNQ319/PRO364, Application: WB, Size:100ug
Catalog Number: 76171-712
Supplier: Boster Biological Technology


Description: APOE/Apolipoprotein E PicoKine* ELISA Kit, Sensitivity: <50pg/ml, Sample type: cell culture supernates, serum, plasma(heparin, EDTA), saliva, milk and urine, Species: Human, Assay: 3.12ng/ml, For Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-554
Supplier: Boster Biological Technology


Description: HDAC3 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HDAC3(411-428aa NEFYDGDHDNDKESDVEI), identical to the related rat and mouse sequences
Catalog Number: 10206-866
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human CXCL16, Immunogen: E.coli, N49-P137, Assay range: 93.7pg/ml-6000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-634
Supplier: Boster Biological Technology


Description: Picoband*NDRG3 Polyclonal antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: E.coli-derived human NDRG3 recombinant protein, Synonyms: Protein NDRG3, N-myc downstream-regulated gene 3 protein, NDRG3, Application: IHC-P, WB, Size: 100ug/vial
Catalog Number: 76172-046
Supplier: Boster Biological Technology


Description: Leptin Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Mouse, Isotype: IgG, Immunogen: 74-109aa KMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLH, Synonyms: Leptin, Obesity factor, Lep, Ob, Application: WB, ELISA, Purity: Immunogen affinity purified, Size: 100ug/vial
Catalog Number: 76173-780
Supplier: Boster Biological Technology


Description: LAMP1 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human LAMP1(403-417aa YLVGRKRSHAGYQTI)
Catalog Number: 10209-598
Supplier: Boster Biological Technology


Description: DGAT1 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Rat, Isotype: IgG, Immunogen: 280-318aa RRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSR, Synonyms: Diacylglycerol O-acyltransferase 1, 2.3.1.20, Application: WB, Size: 100ug/vial
Catalog Number: 76174-458
Supplier: Boster Biological Technology


Description: Metabotropic glutamate receptor 2 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human Metabotropic glutamate receptor 2/GRM2 recombinant protein (Position: N439-A710). Alternative Names: GRM2, GLUR2, glutamate metabotropic receptor 2, Size: 100ug/vial
Catalog Number: 76465-574
Supplier: Boster Biological Technology


Description: IL-18 antibody, polyclonal, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of Human IL18(175-193aa KKEDELGDRSIMFTVQNED).Application: WB
Catalog Number: 10208-052
Supplier: Boster Biological Technology


Description: ALK-1/ACVRL1 PicoKine* ELISA Kit, Sensitivity: <15pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species: Mouse, Assay: 46.9pg/ml, Sandwich High Sensitivity for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-646
Supplier: Boster Biological Technology


1,633 - 1,648 of 5,847