Print…

You Searched For: Molecular+Bioproducts+Inc.


613,137  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"613137"

Rate These Search Results

Image Unavailable-103014-986

Human HGF R/c-MET Protein 1MG

Description: HGF R / c-MET Protein, Host: HEK293 Cells, Species Reactivity: Human, purity: >92%, Molecular Characterization: fused with a C-terminal 8xHis tag, MW of 32.5 kDa, Endotoxin: Less than 1.0 EU per ug, Synonym: MET,AUTS9,HGFR,RCCP2,c-Met, Storage: 4 deg C, Size: 1MG
Catalog Number: 103014-986
Supplier: ACROBIOSYSTEMS
Image Unavailable-103005-826

TAT (47 - 57) 5 mg

Description: TAT (47 - 57), Purity: % Peak Area By HPLC >/= 95%, Molecular Weight: 1559.9, Sequence: (One-Letter Code): YGRKKRRQRRR the most characterized fragment of the HIV transactivator protein (TAT), Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 5 mg
Catalog Number: 103005-826
Supplier: Anaspec Inc
Image Unavailable-102996-558

Peptide YY 0.5 mg

Description: Peptide YY, human, Purity: HPLC >/= to 95%, Molecular Weight: 4309.8, Sequence: YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, Appearance: Lyophilized white powder, is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-558
Supplier: Anaspec Inc
Image Unavailable-10777-982

Recombinant Human IGF-I

Description: Recombinant Human IGF-I, globular proteins containing 70 and 67 AAs, respectively, and 3 intra-molecular disulfide bonds, Animal Free, Source: E.coli, Synonymns: Insulin-like Growth Factor-I, Somatamedin C, IGF-IA, > 98%, Cross Reactivity: Bacteria, Chicken, Cow, Frog, 100UG
Catalog Number: 10777-982
Supplier: PeproTech, Inc.
Image Unavailable-10777-984

Recombinant Human IGF-I

Description: Recombinant Human IGF-I, globular proteins containing 70 and 67 AAs, respectively, and 3 intra-molecular disulfide bonds, Animal Free, Source: E.coli, Synonymns: Insulin-like Growth Factor-I, Somatamedin C, IGF-IA, > 98%, Cross Reactivity: Bacteria, Chicken, Cow, Frog, 500UG
Catalog Number: 10777-984
Supplier: PeproTech, Inc.
Image Unavailable-103004-224

MBP (87 - 99), human 1 mg

Description: MBP (87 - 99), human, Purity: Peak Area By HPLC greater than or equal to 95%, Molecular Weight 1555.9, Sequence (One-Letter Code): VHFFKNIVTPRTP, Physical State: Solid, Storage: -20 degree C Store away from oxidizing agent, Size: 1 mg
Catalog Number: 103004-224
Supplier: Anaspec Inc
Image Unavailable-103013-568

Human CD48/SLAMF2 Protein

Description: CD48/SLAMF2 Protein, Host: HEK293 cells, Species Reactivity: Human, Purity: >95% (SDS-PAGE), Molecular Characterization: His Tag fused with polyhistidine tag at C-terminus, MW 23.2KDa, Synonyms: CD48,BCM1,SLAMF2,BLAST1,BLAST,BLAST1,MEM-102, Storage: 4 deg C, Size: 1mg
Catalog Number: 103013-568
Supplier: ACROBIOSYSTEMS
Image Unavailable-103012-368

Human CD40/TNFRSF5 Protein 200ug

Description: Human CD40/TNFRSF5 Protein, Host: HEK293 cells, species reactivity: human, Purity: >95% SDS-PAGE, Molecular Characterization: Fc Tag is fused with a human IgG1 Fc tag at the C-terminus, MW of 20 kDa, Synonym: CD40,Bp50,CDW40,MGC9013,TNFRSF5,p50, Size: 200ug
Catalog Number: 103012-368
Supplier: ACROBIOSYSTEMS
Image Unavailable-103015-278

ROR1 Protein, Fc Tag 100ug

Description: ROR1 Protein, Fc Tag, Host: HEK293, Species Reactivity: Mouse, Purity: >95% by SDS-PAGE, Molecular Characterization: fused with a human IgG1 Fc tag at the C-terminus, calculated MW of 68.4 kDa, Endotoxin: < 1.0 EU/ ug, Synonym: ROR1, NTRKR1, Storage: 4 deg C, Size: 100ug
Catalog Number: 103015-278
Supplier: ACROBIOSYSTEMS
Image Unavailable-103015-126

PCSK9 Protein 1mg

Description: PCSK9 Protein, Host: HEK293, Species Reactivity: Mouse, Purity: >97% by SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at C-terminus, calculated MW of 72 kDa, Endotoxin: < 1.0 EU/ ug, Synonym: PCSK9,FH3,HCHOLA3,LDLCQ1,NARC1,PC9, Storage: 4 deg C, Size: 1mg
Catalog Number: 103015-126
Supplier: ACROBIOSYSTEMS
Image Unavailable-103012-366

Human CD40/TNFRSF5 Protein 1mg

Description: Human CD40/TNFRSF5 Protein, Host: HEK293 cells, species reactivity: human, Purity: >95% SDS-PAGE, Molecular Characterization: Fc Tag is fused with a human IgG1 Fc tag at the C-terminus, MW of 20 kDa, Synonym: CD40,Bp50,CDW40,MGC9013,TNFRSF5,p50, Size: 1mg
Catalog Number: 103012-366
Supplier: ACROBIOSYSTEMS
Image Unavailable-103013-570

Human CD48/SLAMF2 Protein

Description: CD48/SLAMF2 Protein, Host: HEK293 cells, Species Reactivity: Human, Purity: >95%(SDS-PAGE), Molecular Characterization: His Tag fused with polyhistidine tag at C-terminus, MW 23.2KDa, Synonyms: CD48,BCM1,SLAMF2,BLAST1,BLAST,BLAST1,MEM-102, Storage: 4 deg C, Size: 100ug
Catalog Number: 103013-570
Supplier: ACROBIOSYSTEMS
Image Unavailable-103014-764

Human IL-21 R Protein Fc Tag 200UG

Description: IL-21 R Protein, Fc Tag, Host: HEK293 Cells, Species Reactivity: Human, purity: >92%, Molecular Characterization: human IgG1 at the C-terminus, MW of 51.6 kDa, Endotoxin: Less than 1.0 EU per ug, Synonym: IL21R, CD360, NILR, Storage: 4 deg C, Size: 200UG
Catalog Number: 103014-764
Supplier: ACROBIOSYSTEMS
Image Unavailable-103014-762

Human IL-21 R Protein Fc Tag 1MG

Description: IL-21 R Protein, Fc Tag, Host: HEK293 Cells, Species Reactivity: Human, purity: >92%, Molecular Characterization: human IgG1 at the C-terminus, MW of 51.6 kDa, Endotoxin: Less than 1.0 EU per ug, Synonym: IL21R, CD360, NILR, Storage: 4 deg C, Size: 1MG
Catalog Number: 103014-762
Supplier: ACROBIOSYSTEMS
Image Unavailable-103002-988

OVA (257-264) [SIINFEKL] 5mg

Description: OVA (257-264) [SIINFEKL], Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 963.2, Sequence: (One-Letter Code) SIINFEKL, class I (Kb)-restricted peptide epitope of OVA, an octameric peptide, Appearance: white powder, Storage: At -20 degree C, Size: 5mg
Catalog Number: 103002-988
Supplier: Anaspec Inc
Image Unavailable-103790-100

Recom B7-H2 > 90% Mouse 28.2 Kda 100Ug

Description: B7-H2 Recombinant, Purity: > 90%, Species Reactivity: Mouse, Source: HEK293, Molecular Weight: 28.2 kDa, Tag: polyhistidine tag, Endotoxin: Less than 1.0 EU per ug by the LAL method, Synonyms: ICOSLG, B7-H2, B7H2, B7RP-1, Size: 100ug
Catalog Number: 103790-100
Supplier: ACROBIOSYSTEMS
2,897 - 2,912 of 613,137