You Searched For: EMD MILLIPORE (BIOSCIENCES)


6,677  results were found

SearchResultCount:"6677"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (80055-610)
Supplier: MilliporeSigma
Description: A component of mucoproteins, mucopolysaccharides and mucolipids.

Catalog Number: (80502-396)
Supplier: MilliporeSigma
Description: 25gm. Ethyleneglycol-bis(beta-aminoethyl)-N,N,N',N'-tetraacetic Acid. White solid. Purity: >=98% by complexometry (dry basis). Contaminants: DNases, proteases, RNases: none detected. Heavy metals: <=0.001% (as Pb). RTECS AH3760000, CAS 67-42-5.

Catalog Number: (80054-800)
Supplier: MilliporeSigma
Description: A potent and reversible inhibitor of histone deacetylase

Catalog Number: (80108-900)
Supplier: MilliporeSigma
Description: In 500mM NaCl, 150mM imidazole, 20mM Tris-HCl, 5mM DTT, 1mM EDTA, 10% glycerol, 0.1% CHAPS, pH 7.9

Catalog Number: (80054-388)
Supplier: MilliporeSigma
Description: Recombinant Human E-Selectin (from CHO cells)

SDS


Catalog Number: (82603-578)
Supplier: MilliporeSigma
Description: The Apoptosis Activator VI, CD437/AHPN, also referenced under CAS 125316-60-1, modulates Apoptosis. This small molecule/inhibitor is primarily used for Cancer applications.

Catalog Number: (80600-990)
Supplier: MilliporeSigma
Description: Octaethylene glycol monododecylether (C12E8) solution 10%

Catalog Number: (80057-686)
Supplier: MilliporeSigma
Description: Non-ionic detergent used for immunoprecipitation and for the solubilization of membrane-bound proteins. Supplied as a 10% (W/W) solution of PROTEIN GRADE® TWEEN® 80 detergent.

Catalog Number: (80055-054)
Supplier: MilliporeSigma
Description: Human Chorionic Gonadotropin (from Urine)

Catalog Number: (EM70955-3)
Supplier: MilliporeSigma
Description: Alkali-Soluble Casein is a superior blocking reagent for Western blot applications.

Catalog Number: (80052-244)
Supplier: MilliporeSigma
Description: A synthetic amide of all-trans retinoic acid (RA) that displays reduced toxicity relative to RA while maintaining significant biological activity

Catalog Number: (80017-188)
Supplier: MilliporeSigma
Description: 10-(4'-(N-diethylamino)butyl)-2-chlorophenoxazine, HCl

Catalog Number: (80000-974)
Supplier: MilliporeSigma
Description: Anti-IgG Rat Antibody

Catalog Number: (80053-744)
Supplier: MilliporeSigma
Description: Human Plasminogen (from Plasma)

Catalog Number: (80056-536)
Supplier: MilliporeSigma
Description: This antibody was developed against Recombinant Protein corresponding to amino acids: CEKFGNGESGMGRIPDWTPQAYDPLDVLVPYFVPNTPAARADLAAQYTTVGRMDQGVGLVLQELRDAGVLNDTLVIFTSDNGIPFPSGRTNLYWPGTAEPL.

Catalog Number: (80053-858)
Supplier: MilliporeSigma
Description: Fluorogenic proteasome substrate.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
129 - 144 of 6,677
no targeter for Bottom