You Searched For: AAT BIOQUEST INC


98,479  results were found

SearchResultCount:"98479"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (102144-972)
Supplier: Novus Biologicals


Catalog Number: (102104-850)
Supplier: Novus Biologicals


Catalog Number: (103342-934)
Supplier: Novus Biologicals
Description: MAGEH1, Polyclonal Antibody, Host: Mouse, Species Reactivity: Human, Isotype: IgG, Immunogen: MAGEH1 (NP-054780.2, 1 a.a. - 219 a.a) full-length human Protein, Purity: Protein A purified, Application: WB, ELISA, Storage: -20C or -80C, Size: 0.05mg


Catalog Number: (103278-702)
Supplier: Novus Biologicals
Description: C20orf151, Polyclonal Antibody, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Immunogen: LKAREAEAWEEPTELLGLPSALAGMQDLRLEGALHLLLAQQQLRARARAGSVRPRGQPTPGEMLPSLPVGSDSEGPENEGTRAALAAAGLSGGRH, Synonyms: chromosome 20 open reading frame 151, Application: IHC, Size: 100 ul


Catalog Number: (102112-004)
Supplier: Novus Biologicals


Catalog Number: (103338-396)
Supplier: Novus Biologicals
Description: TOPORS Monoclonal Antibody 0.1mg, Clone: 1A5, Host: Mouse, Species Reactivity: Human, Immunogen: TOPORS (NP-005793, 98 a.a. - 206 a.a) partial recombinant protein with GST tag, Synonym: EC 6.3.2.


Catalog Number: (102114-692)
Supplier: Novus Biologicals


Catalog Number: (103343-778)
Supplier: Novus Biologicals
Description: Serpin A10/ZPI, Monoclonal Antibody, Clone: 1E11, Host: Mouse, Species Reactivity: Human, Isotype: IgG2a Kappa, Immunogen: SERPINA10 (AAH22261, 22 a.a. - 445 a.a) full length recombinant protein with GST tag, Application: WB, ELISA, IP, Size: 0.1mg


Catalog Number: (103251-874)
Supplier: Novus Biologicals


Catalog Number: (103322-656)
Supplier: Novus Biologicals
Description: Biliverdin Reductase B/BLVRB, Monoclonal antibody,Clone: 2F4, Host: Mouse, Species reactivity: Human, Isotype: IgG2a Kappa, Immunogen: BLVRB (NP-000704, 107 a.a. - 206 a.a.) partial recom protein with GST tag, Synonyms: biliverdin reductase B, Size: 0.1 mg


Catalog Number: (103360-800)
Supplier: Novus Biologicals
Description: Prion protein, Polyclonal Antibody, Host: Rabbit, Species reactivity: Avian, Bovine, sheep, Isotype: IgG, Immunogen: Amino acids 162-170 of BSE protein, Synonyms: CD230, CJD, fatal familial insomnia), Application: WB, Size: 0.1 mg


Catalog Number: (103240-718)
Supplier: Novus Biologicals


Catalog Number: (103222-960)
Supplier: Novus Biologicals
Description: Histone Deacetylase 2/HDAC2 Antibody, Polyclonal, Host: Sheep, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: E. Coli-derived recombinant human Histone Deacetylase 2/HDAC2 Pro386-Pro488, Synonyms: EC 3.5.1.98, Applications: WB, Size: 25UG


Catalog Number: (102148-302)
Supplier: Novus Biologicals


Catalog Number: (102251-036)
Supplier: Novus Biologicals


Catalog Number: (103330-490)
Supplier: Novus Biologicals
Description: MAGEA9, Monoclonal antibody, Clone: 2C2, Host: Mouse, Species reactivity: human, Isotype: IgG1 Kappa, Immunogen: MAGEA9 (AAH02351.1, 1 a.a. - 315 a.a.) full-length recom protein, Synonyms: Cancer/testis antigen 1.9, Application: WB, ELISA, Size: 0.1 mg


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,065 - 2,080 of 98,479
no targeter for Bottom