You Searched For: NOVUS BIOLOGICALS INC MS


98,476  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"98476"
Description: TRAF-1, Polyclonal Antibody, Host: Rabbit, Species reactivity: mouse, Isotype: IgG, Immunogen: A synthetic peptide corresponding to amino acids 51-69 (CRADNLHPVSPGSPLTQEK), Synonyms: EBI6, EBI6MGC:10353, Application: WB, IHC, IHC-P, IP, Size: 0.05 ml
Catalog Number: 103358-720
Supplier: Novus Biologicals


Catalog Number: 102143-320
Supplier: Novus Biologicals


Catalog Number: 103242-120
Supplier: Novus Biologicals


Catalog Number: 103242-274
Supplier: Novus Biologicals


Description: GCR2, Monoclonal Antibody, Clone: 1A11, Host: Mouse, Species Reactivity: Human, Immunogen: SGT1 (AAH00721, 1 a.a. - 645 a.a) full length recombinant protein with GST tag, Application: WB, ELISA, ICC/IF, Storage: -20 Deg C or -80C, Size: 0.1mg
Catalog Number: 103340-556
Supplier: Novus Biologicals


Catalog Number: 102131-886
Supplier: Novus Biologicals


Catalog Number: 102244-686
Supplier: Novus Biologicals


Description: Cardiotrophin-1/CT-1, Polyclonal Antibody [Unconjugated], Host: Goat, Species: Human, Isotype: IgG, Immunogen: E. coli-derived recombinant human Cardiotrophin-1/CT-1, Synonyms: cardiotrophin 1, cardiotrophin-1, CT-1CT1, CTF1, Application: WB, Size: 100UG
Catalog Number: 103231-028
Supplier: Novus Biologicals


Description: NBR1, Polyclonal antibody, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Mouse, Rat, Immunogen: YSTPRLPAALEQVRLQKQVDKNFLKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLQSNTLMLPLQPC, Synonyms: FLJ98272KIAA0049, Application: WB, IHC, IHC-P, Size: 100UL
Catalog Number: 103276-610
Supplier: Novus Biologicals


Description: FNTA, Polyclonal antibody, Host: Rabbit, Isotype: IgG, Species: Human, Immunogen: developed against Recombinant Protein corresponding to amino acids, Synonyms: CAAX farnesyltransferase subunit alpha, EC 2.5.1.58, EC 2.5.1.59, Application: WB, IHC, Size: 100UL
Catalog Number: 103267-728
Supplier: Novus Biologicals


Description: EHBP1, Polyclonal antibody, Host: rabbit, Isotype: IgG, Species reactivity: human, Synonyms: EH domain binding protein 1, Application: WB, ICC/IF, IHC, IHC-P, Purity: Immunogen affinity purified, Storage: 4 deg C/-20 deg C, Size: 100 ul
Catalog Number: 103283-408
Supplier: Novus Biologicals


Description: THAP5 Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Isotype: IgG, Synonyms: DKFZp313O1132, THAP domain containing 5, THAP domain-containing protein 5, Purity: Immunogen affinity purified, Application: IHC, IHC-P, Storage: 4 degree C, Size: 0.1 ml
Catalog Number: 103284-442
Supplier: Novus Biologicals


Description: PCNXL2, Polyclonal antibody, Host: Rabbit, Species: Human, Isotype: IGG Purity: Immunogen affinity purified, Buffer : PBS (pH 7.2) and 40% Glycerol, Synonyms: pecanex-like 2 (Drosophila), Applications: IHC-P, Size: 100ul
Catalog Number: 103285-326
Supplier: Novus Biologicals


Catalog Number: 102106-092
Supplier: Novus Biologicals


Catalog Number: 102234-618
Supplier: Novus Biologicals


Catalog Number: 102203-172
Supplier: Novus Biologicals


881 - 896 of 98,476