Print…

You Searched For: KEWAUNEE EVOLUTION


98,476  results were found

Refine Results Sort by
SearchResultCount:"98476"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-102128-308

Golden Syrian Hamster IgG Antibody [HRP]

Catalog Number: (102128-308)
Supplier: Novus Biologicals
Image Unavailable-103272-370

SNX16 Polyclonal antibody 100UL

Catalog Number: (103272-370)
Supplier: Novus Biologicals
Description: SNX16, Polyclonal antibody, Host: Rabbit, Isotype: IgG, Species: Human, Mouse, Rat, Immunogen: Recombinant Protein corresponding to amino acidsPurity: Immunogen Affinity, Synonyms: DKFZp666H147, sorting nexin 16, Application: WB, ICC/IF, IHC, IHC-P, Size: 100UL
Image Unavailable-103276-342

FDX1 Polyclonal antibody 100UL

Catalog Number: (103276-342)
Supplier: Novus Biologicals
Description: FDX1, Polyclonal antibody, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Mouse, Rat, Immunogen: NLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGC, Synonyms: Adrenal ferredoxinadrenodoxin, mitochondrial, Application: WB, ICC/IF, IHC, IHC-P, Size: 100UL
Image Unavailable-103259-306

NARFL Polyclonal 100ul

Catalog Number: (103259-306)
Supplier: Novus Biologicals
Description: NARFL, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: Igg, Immunogen: This antibody was developed against Recombinant Protein, Synonyms: Nuclear prelamin A recognition factor-like protein, LET1 like/JFP15, Applications: WB, ICC/IF, IHC, Size: 100ul
Image Unavailable-103408-872

Neuroligin 4X/NLGN4X Polyclonal antibody 0.1 mg

Catalog Number: (103408-872)
Supplier: Novus Biologicals
Description: Neuroligin 4X/NLGN4X, Polyclonal antibody, Host: Goat, Species: Human, Synonyms: ASPGX2, AUTSX2, HLNX, HNL4X, HNLX, KIAA1260AUTSX2, MGC22376, neuroligin 4, X-linked, Neuroligin 4X, NL4, NLGN, NLGN4, NLGN4neuroligin 4, NLGN4X, X-linked, Size: 0.1 mg
Image Unavailable-103223-192

Transgelin/TAGLN/SM22 alpha Polyclonal Antibody 25UG

Catalog Number: (103223-192)
Supplier: Novus Biologicals
Description: Transgelin/TAGLN/SM22 alpha [Unconjugated], Polyclonal Antibody, Host: Sheep, Species reactivity: Human, Mouse, Rat, Isotype: IgG, synonyms: SM2222 kDa actin-binding protein, Application: WB, Simple Western, IHC, ICC, Size: 25UG
Image Unavailable-102120-756

EIF5 Antibody

Catalog Number: (102120-756)
Supplier: Novus Biologicals
Image Unavailable-103400-612

CD39/ENTPD1 Monoclonal Antibody 100UL

Catalog Number: (103400-612)
Supplier: Novus Biologicals
Description: CD39/ENTPD1, Monoclonal Antibody, Clone: AC2, Host: Mouse, Species reactivity: Human, Isotype: IgG2b Lambda, Conjugate: DyLight 680, Immunogen: EBV-transformed human B lymphoblastoid cell line, Application: WB, Flow, Purity: Protein G purified, Size: 100UL
Image Unavailable-102217-524

TMEM209 Antibody

Catalog Number: (102217-524)
Supplier: Novus Biologicals
Image Unavailable-102208-480

SLAM Antibody

Catalog Number: (102208-480)
Supplier: Novus Biologicals
Image Unavailable-103278-112

LEUTX PAB 100 ul

Catalog Number: (103278-112)
Supplier: Novus Biologicals
Description: LEUTX, Polyclonal Antibody, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Immunogen: AKWKRQQRQQMQTRPSLGPANQTTSVKKEETPSAITTANIRPVSPGISDANDHDLREPSGIKNPGGASASARVSSW, Synonyms: arginine-fifty homeobox-like pseudogene, leucine twenty homeobox, Application: WB, Size: 100 ul
Image Unavailable-102208-370

FBXL16 Peptide

Catalog Number: (102208-370)
Supplier: Novus Biologicals
Image Unavailable-102154-520

Macrophage Scavenger Receptor I Peptide

Catalog Number: (102154-520)
Supplier: Novus Biologicals
Image Unavailable-102107-094

HMGB1 Antibody

Catalog Number: (102107-094)
Supplier: Novus Biologicals
Image Unavailable-103277-534

XAB1 Polyclonal antibody 100UL

Catalog Number: (103277-534)
Supplier: Novus Biologicals
Description: XAB1, Polyclonal antibody, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Mouse, Rat, Mouse, Immunogen: LNQETTYVSNLTRSMSLVLDEFYSSLRVVGVSAVLGTGLDELFVQVTSAAEEYEREYRPEYERLKKSLANAESQQQREQLERLRKDMGSV, Application: WB, ICC/IF, IHC, IHC-P, Size: 100UL
Image Unavailable-102153-908

14-3-3 eta Lysate

Catalog Number: (102153-908)
Supplier: Novus Biologicals
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
-143 - -128 of 98,476
no targeter for Bottom