Print…

You Searched For: FOAMTEC INTERNATIONAL, LLC.


98,476  results were found

Refine Results Sort by
SearchResultCount:"98476"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-102184-334

NT5M Antibody

Catalog Number: (102184-334)
Supplier: Novus Biologicals
Image Unavailable-103343-516

PARD6A Polyclonal Antibody 0.1mg

Catalog Number: (103343-516)
Supplier: Novus Biologicals
Description: PARD6A, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Isotype: IgG, Immunogen: PARD6A (NP-001032358.1, 1 a.a. - 345 a.a) full-length human Protein, Purity: Protein A purified, Application: WB, ELISA, Storage: -20C, Size: 0.1mg
Image Unavailable-102182-544

Niemann-Pick type C2 Antibody

Catalog Number: (102182-544)
Supplier: Novus Biologicals
Image Unavailable-102135-698

Whole Normal Papilla Muscle Lysate

Catalog Number: (102135-698)
Supplier: Novus Biologicals
Image Unavailable-103308-776

PTPRN2 Monoclonal antibody 0.1 mg

Catalog Number: (103308-776)
Supplier: Novus Biologicals
Description: PTPRN2 Monoclonal antibody, Clone: 1C5, Host: Mouse, Species Reactivity: Human, Isotype: IgG1 Kappa, Immunogen: PTPRN2 (NP-002838, 108 aa - 212 aa) partial recombinant protein with GST tag, Synonym: ICAARIARPTPRP, phogrin, Application: WB, Size: 0.1 mg
Image Unavailable-102214-584

SSX7 Antibody

Catalog Number: (102214-584)
Supplier: Novus Biologicals
Image Unavailable-102240-286

ZC4H2 Lysate

Catalog Number: (102240-286)
Supplier: Novus Biologicals
Image Unavailable-102199-702

C2orf42 Antibody

Catalog Number: (102199-702)
Supplier: Novus Biologicals
Image Unavailable-102131-458

Niemann-Pick type C1 Like-1 Antibody [Biotin]

Catalog Number: (102131-458)
Supplier: Novus Biologicals
Image Unavailable-103222-406

GFAP PAB Antibody 50UG

Catalog Number: (103222-406)
Supplier: Novus Biologicals
Description: GFAP Antibody, Polyclonal, Host: Sheep, Species reactivity: Human, Isotype: IgG, Immunogen: E. coli-derived recombinant human GFAP, Synonym: FLJ45472, GFAP astrocytes, glial fibrillary acidic protein, Application: WB, ICC, Size: 50UG
Image Unavailable-102712-582

VEZT Antibody

Catalog Number: (102712-582)
Supplier: Novus Biologicals
Image Unavailable-103236-102

PAB SHEEP SLURP1 HUMAN IGG 100UG FOR IHC

Catalog Number: (103236-102)
Supplier: Novus Biologicals
Image Unavailable-102712-912

ZNF514 Antibody

Catalog Number: (102712-912)
Supplier: Novus Biologicals
Image Unavailable-103285-636

RPL3L Polyclonal antibody 100ul

Catalog Number: (103285-636)
Supplier: Novus Biologicals
Description: RPL3L, Polyclonal antibody, Host: Rabbit, Species: Human, Isotype: IGG Purity: Immunogen affinity purified, Synonyms: 60S ribosomal protein L3-like, ribosomal protein L3-like, Applications: IHC-P, Size: 100ul
Image Unavailable-103278-246

TXLNB Polyclonal Antibody 100 ul

Catalog Number: (103278-246)
Supplier: Novus Biologicals
Description: TXLNB, Polyclonal Antibody, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Immunogen: ALQEERNELHKKIRDAEISEKDDQSQHNSDEEPESNVSVDQEIDAEEVNSVQTAVKNLATAFMIIHHPESTPHQSKETQPEI, Affinity purified, Synonyms: Taxilin beta, Application: IHC, IHC-P, Size: 100 ul
Image Unavailable-103281-430

DHX8 Polyclonal antibody 100 UL

Catalog Number: (103281-430)
Supplier: Novus Biologicals
Description: DHX8 Polyclonal antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Synonyms: DDX8ATP-dependent RNA helicase DHX8, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 8 (RNA helicase), DEAH (Asp-Glu-Ala-His) box polypeptide 8, Uses: ICC/IF, IHC-P, Size: 100 UL
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
-127 - -112 of 98,476
no targeter for Bottom