Print…

You Searched For: Tetramethylammonium+acetate


98,481  results were found

Refine Results Sort by
SearchResultCount:"98481"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-103280-380

SPINK5 PAB 100UL

Catalog Number: (103280-380)
Supplier: Novus Biologicals
Description: SPINK5, Polyclonal antibody, Host: Rabbit, Isotype: IgG, Species reactivity: human, Immunogen: DGRLGCTRENDPVLGPDGKTHGNKCAMCAELFLKEAENAKREGETRIRRNAEKDFCKEYEKQVRNGRLFCTRESDPVRGPDGRMHGNKCALCAEIFKQRFSEENSKTDQN, Synonyms: Kazal type 5, Application: IHC, IHC-P, Size: 100UL
Image Unavailable-103326-200

Fibroblast Activation Protein alpha Monoclonal antibody 0.1 mg

Catalog Number: (103326-200)
Supplier: Novus Biologicals
Description: Fibroblast Activation Protein alpha Monoclonal antibody, Clone: 1E5, Host: Mouse, Species: Human, Isotype: IgG2a Kappa, Immunogen: FAP (AAH26250 525aa-624aa) partial recombinant protein, Synonyms: FAP, Uses: WB, ELISA, IP, Size: 0.1 mg
Image Unavailable-102142-552

ERF1 Lysate

Catalog Number: (102142-552)
Supplier: Novus Biologicals
Image Unavailable-102238-558

DNAJC5B Lysate

Catalog Number: (102238-558)
Supplier: Novus Biologicals
Image Unavailable-102201-698

C14orf43 Antibody

Catalog Number: (102201-698)
Supplier: Novus Biologicals
Image Unavailable-102710-446

PGM2 Antibody

Catalog Number: (102710-446)
Supplier: Novus Biologicals
Image Unavailable-103231-382

Netrin-1 Polyclonal Antibody 100ug

Catalog Number: (103231-382)
Supplier: Novus Biologicals
Description: Netrin-1, Polyclonal Antibody, Host: Sheep, Species reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: Mouse myeloma cell line NS0-derived recombinant human Netrin-1, Synonyms: netrin 1, NTN1, NTN1Lnetrin 1, mouse, homolog of, Application: WB, Size: 100ug
Image Unavailable-102184-320

MRPL48 Antibody

Catalog Number: (102184-320)
Supplier: Novus Biologicals
Image Unavailable-102168-678

Sulfatase 2 Antibody (2B4) [Biotin]

Catalog Number: (102168-678)
Supplier: Novus Biologicals
Image Unavailable-103328-594

HSF4 Monoclonal antibody 0.1 mg

Catalog Number: (103328-594)
Supplier: Novus Biologicals
Description: HSF4 Monoclonal antibody, Clone: 2A2, Host: Mouse, Species: Human, Isotype: IgG2b Kappa, Immunogen: HSF4 (NP-001529, 121 a.a. - 220 a.a.) partial recombinant protein with GST tag, Synonyms: ATHSF4, AT-HSFB1, cataract, Marner, Application: WB, ELISA, Size: 0.1 mg
Image Unavailable-103283-310

RAB6A Polyclonal antibody 100 ul

Catalog Number: (103283-310)
Supplier: Novus Biologicals
Description: RAB6A, Polyclonal antibody, Host: rabbit, Isotype: IgG, Species reactivity: human, mouse, rat, Synonyms: GTP-binding protein RAB6B, Oncogene RAB6, Rab GTPase, Application: WB, ICC/IF, IHC, IHC-P, Purity: Immunogen affinity purified, Size: 100 ul
Image Unavailable-102123-736

NOX4 Peptide

Catalog Number: (102123-736)
Supplier: Novus Biologicals
Image Unavailable-103270-338

EMP2 Polyclonal Antibody 100UL

Catalog Number: (103270-338)
Supplier: Novus Biologicals
Description: EMP2, Polyclonal Antibody, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Mouse, Immunogen: Developed against Recombinant Protein corresponding to amino acids, Synonyms: EMP2, epithelial membrane protein 2, Application: Western Blot, IHC, IHC-P, Size: 100UL
Image Unavailable-102249-534

Integrin beta 2/CD18 Lysate

Catalog Number: (102249-534)
Supplier: Novus Biologicals
Image Unavailable-102205-274

HSDL1 Antibody

Catalog Number: (102205-274)
Supplier: Novus Biologicals
Image Unavailable-102241-150

RRP1B Lysate

Catalog Number: (102241-150)
Supplier: Novus Biologicals
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,281 - 1,296 of 98,481
no targeter for Bottom