Print…

You Searched For: NOVUS BIOLOGICALS INC MS


377,029  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"377029"

Rate These Search Results

Image Unavailable-103011-020

5-FAM cadaverine

Description: 5-FAM cadaverine is an excellent building block to prepare fluorescent ligands for receptor binding assays. Additionally, we have proven that the fluorescein cadaverine derivative is also a good transglutaminase substrate for site-specific protein labeling like FITC cadaverine.
Catalog Number: 103011-020
Supplier: Anaspec Inc
Image Unavailable-76484-788

PhosphoWorks™ Fluorimetric ATP Assay Kit, AAT Bioquest

Description: Adenosine triphosphate (ATP) plays a fundamental role in cellular energetics, metabolic regulation and cellular signaling.
Catalog Number: 76484-788
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Image Unavailable-76303-912

Human Recombinant ICOS (from CHO cells)

Description: PeproTech's CHO cell-derived Recombinant Human ICOS Fc is a glycosylated, homodimer 79.4 kDa of 706 amino acid residues whose monomer consists of the 120-amino-acid-length extracellular portion of ICOS fused to the 231-amino-acid-length Fc portion of human IgG1 by two glycines. The calculated molecular weight of Recombinant Human ICOS Fc dimer is 79.4 kDa; however, due to glycosylation, it migrates at an apparent molecular weight of approximately 40-45 kDa by SDS-PAGE analysis under reducing conditions.
Catalog Number: 76303-912
Supplier: PeproTech, Inc.
Image Unavailable-103003-738

Bovine;Human;Mouse;Rat Orexin A

Description: This hypothalamic neuropeptide has been shown to regulate feeding behavior.
Sequence:Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 (Disulfide bridge: 6-12 and 7-14)
MW:3561.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103003-738
Supplier: Anaspec Inc
Image Unavailable-103007-164

HCAM-2

Description: A pertussis toxin (PTx) enzyme substrate that is labeled with 6-FAM (6-carboxyfluorescein), Abs/Em=494 nm/521 nm.
Sequence:6-FAM-VFDAVTDVIIKNNLKECGLY
MW:2613 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103007-164
Supplier: Anaspec Inc
Image Unavailable-103006-882

E alpha (52–68)

Description: This peptide is MHC class II antigen E alpha
Sequence:ASFEAQGALANIAVDKA
MW:1675.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103006-882
Supplier: Anaspec Inc
Image Unavailable-103006-280

Influenza NP (147-155)

Description: This peptide is a H-2Kd-restricted epitope from Influenza nucleoprotein (147-155).
Sequence:TYQRTRALV
MW:1107.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103006-280
Supplier: Anaspec Inc
Image Unavailable-102996-430

Dipeptidylaminopeptidase IV Substrate, AMC (7-amino-4-methylcoumarin)

Description: This is a fluorescent dipeptidylaminopeptidase IV substrate, Abs/Em=353/442 nm.
Sequence:GP-AMC
MW:329.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 102996-430
Supplier: Anaspec Inc
Image Unavailable-103006-400

Plants Phytochelatin 6

Description: A glutathione-derived heavy metal-detoxifying peptide of higher plants consisting of 6 units of gammaGlu-Cys.
Sequence:(γE-C)6-G
MW:1468.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103006-400
Supplier: Anaspec Inc
Image Unavailable-103006-504

Human Beta-Amyloid (1-40)-Lys(Biotin)-NH₂, Biotin, AnaSpec

Description: This is amino acids 1 to 40 fragment of human beta-amyloid differing from those in rat, mouse by three amino acid residues in Arg5, Tyr10, and His13. This peptide is biotinylated at the C-terminus.
Catalog Number: 103006-504
Supplier: Anaspec Inc
Image Unavailable-103007-750

HIV Gp91 Ds-Tat Peptide

Description: This is a control peptide for gp91 ds-tat.
Sequence: YGRKKRRQRRRCLRITRQSR-NH2
MW: 2673.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Catalog Number: 103007-750
Supplier: Anaspec Inc
Image Unavailable-103000-710

Cytomegalovirus CEF CMV

Description: HLA-A*0201-restricted epitope from Cytomegalovirus pp65 (495-503).
Sequence: NLVPMVATV
MW: 943.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Catalog Number: 103000-710
Supplier: Anaspec Inc
Image Unavailable-103011-378

BSB [(trans,trans)-1-Bromo-2,5-bis-(3-hydroxycarbonyl-4-hydroxy)styrylbenzene] fluorescent dye

Description: BSB, derived from the structure of Congo Red, is shown to bind to a wide range of amyloid inclusions in situ.
Catalog Number: 103011-378
Supplier: Anaspec Inc
Image Unavailable-102999-854

Human Beta-Amyloid (1-43)

Description: Solid Aß (1-43) fibril is the most fibrillogenic of all the Aß peptides known.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT
Molecular Weight: 4615.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: 102999-854
Supplier: Anaspec Inc
Product Image-76483-414

OxiVision™ Green hydrogen peroxide sensor

Description: Despite the importance of H₂O₂ to human health and disease, the molecular mechanisms of its production, accumulation, trafficking, and function are insufficiently understood due to the lack of sensitive and specific H₂O₂ sensors that can be used in live cells.
Catalog Number: 76483-414
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Image Unavailable-103371-828

Lithium bis(trifluoromethylsulfonyl)imide

Description: Bis(trifluoromethane)sulfonimide lithium salt, CAS Number: 90076-65-6, Molecular Formula: C2F6LiNO4S2, Molecular weight: 287.09 g/mol, Color: white to off-white, Form: crystalline powder, Storage: room temperature, size: 0.5KG
Catalog Number: 103371-828
Supplier: Biosynth International Inc

SDS


2,641 - 2,656 of 377,029