You Searched For: Hytest Ltd

Description: HiLyte* Fluor 488 hydroxylamine, HCl salt *single isomer*, Abs/Em = 498/525 nm, Purity: HPLC >/=95%, Sequence (1-Letter Code): HiLyte* Fluor 488 C2-aminooxyacetamide, HCl salt *single isomer*, MW: 525.94, Storage: -20degree C, Size: 1mg

Catalog Number: 103006-524

Supplier: Anaspec Inc

Sale

Description: Cys(Npys) Antennapedia Peptide, amide, 16 amino acid region, Purity: HPLC >/= 95%, Sequence (One-Letter Code): C(Npys)-RQIKIWFQNRRMKWKK-NH2, Molecular Weight: 2505, Physical State: Solid, for conjugation studies, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-272

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 HCV Protease Assay Kit *Fluorimetric*, Components: HCV NS3/4A protease substrate 120 ul, 5-FAM 100 u
M, 5 ul, 2X Assay buffer 10 mL, Stop solution 10 mL, DTT 1 M, 0.5 mL, Pep4AK 50 ul, 600 u
M, with Convenient Format, Enhanced Value

Catalog Number: 103010-174

Supplier: Anaspec Inc

Sale

Description: Human MMP-12 (Recombinant, Catalytic Domain), Source: E. Coli, Purity: Greater than 95% as determined by SDS-PAGE, Amino acid 106-267, 18 kDa, expressed as catalytic domain, Synonym: Matrix metalloproteinases, Storage: -80 degree C, Size: 50ug

Catalog Number: 103001-348

Supplier: Anaspec Inc

Sale

Description: [pSer28]-Histone H3 (21-44)-GK, Purity: HPLC >/= 95%, MW: 2997.5, Sequence: [ATKAARK-pS-APATGGVKKPHRYRPGG-K(Biotin)] phosphorylated at Ser28 with an additional C-terminal glycine followed by a biotinylated lysine. Biotin - labeled, Store: -20 deg C, Size: 1mg

Catalog Number: 103009-488

Supplier: Anaspec Inc

Sale

Description: QXL* 490 acid, Molecular Weight: 377.42, Solvent System DMSO or DMF, dyes are the optimized quenchers for EDANS, AMCA and most coumarin fluorophores, Their absorption spectra perfectly overlap with the fluorescence spectra of EDANS and AMCA, Storage -20 deg C, size: 10 mg

Catalog Number: 103010-222

Supplier: Anaspec Inc

Sale

Description: [Asp370] - Tyrosinase (368 - 376) YMDGTMSQV, Purity: HPLC >/=95%, Sequence (Three-Letter Code): H - Tyr - Met - Asp - Gly - Thr - Met - Ser - Gln - Val - OH, Molecular weight: 1031.2, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-502

Supplier: Anaspec Inc

Sale

Description: Prototype of RGD-containing peptide, Purity: HPLC >/- 95%, Molecular Weight: 1091.6, Sequence: FITC-LC-Gly-Arg-Gly-Asp-Ser-Pro-OH, label: FITC, Appearance: Lyophilized red powder, This is a fluorescent labeled Prototype of RGD-containing peptide, Size: 1 mg

Catalog Number: 103003-270

Supplier: Anaspec Inc

Sale

Description: PACAP (6-38), amide, human, ovine, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4024.8, Sequence: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2, This peptide is a potent antagonist of PACAP 38 and is much more potent and selective than PACAP, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-260

Supplier: Anaspec Inc

Sale

Description: Exendin 4, Purity: HPLC >/- 95%, Molecular Weight: 4186.6, Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, Appearance: Lyophilized white powder, is an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake, Size: 1 mg

Catalog Number: 103003-726

Supplier: Anaspec Inc

Sale

Description: Di-4-ANEPPS, Fluorescence response less susceptible to cell and tissue types, MW: 480.7, Spectral Properties: Abs/Em = 496/705 nm, Solvent System: Water, Physical State: Solid, Storage -20 deg C, desiccated and protected from light. Store away from oxidizing agent, Size: 5 mg

Catalog Number: 103011-252

Supplier: Anaspec Inc

Sale

Description: Histone H4 (1-7), N-Terminal, Sequence: SGRGKGG, Purity: By HPLC greater than or equal to 95%, This is amino acids 1 to 7 fragment of the histone H3, Molecular Weight: 617.7, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-508

Supplier: Anaspec Inc

Sale

Description: 5-FAM-PLSRTLSVSS-NH2, Purity: HPLC >/- 95%, Molecular Weight: 1403.5, Storage -20 deg C, Size 1 mg

Catalog Number: 103003-194

Supplier: Anaspec Inc

Sale

Description: M13 Skeletal Muscle Myosin Light Chain Kinase Peptide, SK - MLCK M13, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 2964.5, Sequence: (One-Letter Code) KRRWKKNFIAVSAANRFKKISSSGAL, Storage: At -20 degree C, Size: 5mg

Catalog Number: 103002-832

Supplier: Anaspec Inc

Sale

Description: [Lys(Me1)23]-Histone H3 (21-44)-GK(Biotin); H3K23(Me1), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2946.5, Sequence: AT-K(Me1)-AARKSAPSTGGVKKPHRYRPG-GK(Biotin)-NH2, Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-302

Supplier: Anaspec Inc

Sale

Description: Peptide YY, human, Purity: HPLC >/= to 95%, Molecular Weight: 4309.8, Sequence: YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, Appearance: Lyophilized white powder, is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-560

Supplier: Anaspec Inc

Sale