You Searched For: Jopak Verpakkingen

Description: MOG (89-113), human HLA-DR2 restricted MOG epitope, peptide sequence is found in residues 89 to 113 of human MOG, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): RFSDEGGFTCFFRDHSYQEEAAMEL, Molecular Weight: 2973.2, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-678

Supplier: Anaspec Inc

Sale

Description: MLC-derived peptide, a protein kinase associated with apoptosis and tumor suppression, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): KKRPQRRYSNVF, Molecular Weight: 1578.9, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-984

Supplier: Anaspec Inc

Sale

Description: ACTH (1 - 39), human, Purity: HPLC >/- 95%, Molecular Weight: 4541.1, Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF, Adrenocorticotropic hormone (ACTH), also known as corticotropin, is a cleavage product from a larger precursor proopiomelanocortin, Size: 0.5 mg

Catalog Number: 103003-906

Supplier: Anaspec Inc

Sale

Description: MCRAMP, mouse cathelicidin-related antimicrobial peptide (mCRAMP) is the sole murine cathelicidin, Purity: HPLC>/=95%, Sequence (One-Letter Code): GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ, Molecular weight: 3878.7, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-558

Supplier: Anaspec Inc

Sale

Description: ADHP, Synonym: 10 - Acetyl - 3,7 - dihydroxyphenoxazine, CAS 119171-73-2, Purity: >/= 95% by HPLC, most sensitive and stable fluorogenic probe for detecting HRP and H2O2, MW 257.24, Spectral Properties Abs/Em = 280/none nm, Solvent System: DMSO, Storage: -20 deg C, Size: 25 mg

Catalog Number: 103011-304

Supplier: Anaspec Inc

Sale

Description: Collagen (Type IV), FAM conjugated, heavily labeled with a fluorescein derivative, Concentration: 1 mg/mL, Fluorescence: Excitation/Emission wavelength= 490 nm/520 nm, Spectral Properties: Abs/Em = 492/515 nm, Solvent System: Water insoluble, Storage -20 deg C, Size: 1 mg

Catalog Number: 103011-294

Supplier: Anaspec Inc

Sale

Description: Scrambled TRAP Fragment, reversed sequence of the first two amino acids, Purity: By HPLC >/= 95%, Molecular Weight 747.9, Sequence (One-Letter Code) FSLLRN-NH2, Sequence (Three-Letter Code) H - Phe - Ser - Leu - Leu - Arg - Asn - NH2, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103005-892

Supplier: Anaspec Inc

Sale

Description: CEF2, Influenza Virus PA (46 - 54), FMYSDFHFI, HLA-A*0201 restricted epitope, Sequence (Three-Letter Code) H - Phe - Met - Tyr - Ser - Asp - Phe - His - Phe - Ile - OH, Molecular Weight: 1206.4, Physical State: Solid, Storage: -20degree C, Size: 1mg

Catalog Number: 102997-140

Supplier: Anaspec Inc

Sale

Description: Histone H3 (1-21), Biotinylated, used to investigate the mechanisms of ethanol-induced histone H3 acetylation in rat hepatocytes, Purity: HPLC >/=95%, Sequence (1-Letter Code): ARTKQTARKSTGGKAPRKQLA-GG-K(BIOTIN)-NH2, MW: 2723.2, Storage: -20degree C, Size: 1mg

Catalog Number: 103006-912

Supplier: Anaspec Inc

Sale

Description: Glucagon-Like Peptide 1, GLP-1 (7-36), amide, human, Purity: HPLC >/= to 95%, Molecular Weight: 3297.7, Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, Appearance: Lyophilized white powder, This peptide shares sequence with preproglucagon, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-228

Supplier: Anaspec Inc

Sale

Description: SAM PEP 1, FAM labeled, AMPK substrate peptide, FAM labeled, Sequence: 5-FAM-HMRSAMSGLHLVKRR, Purity: HPLC >/= 95%, can be used as a substrate for APK in vitro kinase assays, Molecular Weight: 2137.5, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-732

Supplier: Anaspec Inc

Sale

Description: 5(6)-TAMRA, SE, Synonym: 5-(and-6)-Carboxytetramethylrhodamine, succinimidyl ester; 5(6)-TAMRA, NHS ester, for preparing peptide, protein, nucleotide, nucleic acid conjugates, Molecular Weight: 527.53, Molecular Formula: C29H25N3O7, Appearance: Dark red solid, Size: 100 mg

Catalog Number: 103010-846

Supplier: Anaspec Inc

Sale

Description: Linear C5a Receptor Antagonist, rat, human, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 886.1, Sequence: FKP-(D-Cha)-Wr, linear peptide is derived from C-terminus of chemokine, complement fragment 5 anaphylatoxin, Storage: -20 deg C, Size: 1mg

Catalog Number: 103008-728

Supplier: Anaspec Inc

Sale

Description: 26Rfa, Hypothalamic Peptide, human, expressed in the ventromedial hypothalamic nucleus, Purity: HPLC >/= 95%, Sequence (One-Letter Code): TSGPLGNLAEELNGYSRKKGGFSFRF-NH2, MW: 2832.2, Physical State: Lyophilized White Powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-892

Supplier: Anaspec Inc

Sale

Description: T20 36-residue peptide corresponds to aa 643-678 of the C-terminus of HIV-1LAIgp41. It strongly inhibits HIV-1 viral fusion with an EC50 of 1 ng/ml, Purity: HPLC>/=95%, Sequence (One-Letter Code): Ac-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2, Molecular weight: 4492, Size: 1 mg

Catalog Number: 103006-446

Supplier: Anaspec Inc

Sale

Description: MOG (35-55), mouse, rat, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 2582, Sequence: MEVGWYRSPFSRVVHLYRNGK (1-letter code), member of the immunoglobulin superfamily and is expressed in central nervous system (1-3), Storage: At -20 Degree C, Size: 10mg

Catalog Number: 103002-982

Supplier: Anaspec Inc

Sale