You Searched For: Hytest Ltd

Description: [Pro19]-beta-Amyloid (1-42); F19P beta - Amyloid (1 - 42), Human, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 4464.1, Sequence: DAEFRHDSGYEVHHQKLVPFAEDVGSNKGAIIGLMVGGVVIA, peptide is beta-amyloid (1-42), Storage: -20 degree C, Size: 1mg

Catalog Number: 103009-022

Supplier: Anaspec Inc

Sale

Description: SensoLyte* AMC Calpain Activity Assay Kit *Fluorimetric*, Components: Calpain Substrate 4 mM, 50 uL, AMC 4 mM, 10 uL, Assay Buffer 20 mL, Human Calpain 1.25 mg/mL, 40 uL, Calpain Inhibitor 50 uM, 10 uL, DTT 1M, 20 uL, storage: -20 deg C

Catalog Number: 103010-506

Supplier: Anaspec Inc

Sale

Description: SensoLyte* pNPP Alkaline Phosphatase Assay Kit *Colorimetric*, Components: pNPP 25 mL, 10X Assay buffer 50 mL, Stop solution 25 mL, Triton-X-100 500 uL, Alkaline Phosphatase Standard, Calf Intestine 10 ug/mL, 50 uL, storage: -20 deg C

Catalog Number: 103010-494

Supplier: Anaspec Inc

Sale

Description: DEAC, SE, Synonym: 7-Diethylaminocoumarin-3-carboxylic acid, succinimidyl ester, Purity: >/=95% by HPLC, blue fluorescent building block for labeling amine-containing biomolecules, MW: 358.35, Spectral Properties: Abs/Em = 432/472 nm, Solvent System DMF or Acetonitrile, Size: 25 mg

Catalog Number: 103010-900

Supplier: Anaspec Inc

Sale

Description: Uroguanylin (Rat) natriuretic peptide, a hormone that regulates sodium excretion by the kidney when excess NaCl is consumed, Purity: HPLC >/=95%, Sequence(1-Letter Code): TDECELCINVACTGC (Disulfide bond between Cys4-Cys12 and Cys7-Cys15), MW: 1569.8, Storage: -20C, Size: 1mg

Catalog Number: 103006-888

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 MMP-2 Assay Kit *Fluorimetric*, Components: MMP-2 substrate 60 ul, 5-FAM-Pro-Leu-OH 1 mM, 10 ul, APMA 1 M, 20 ul, Assay buffer 20 mL, Stop solution 10 mL, with Convenient Format, Optimized Performance, Enhanced Value, High Speed, Assured Reliability

Catalog Number: 103010-232

Supplier: Anaspec Inc

Sale

Description: O-linked GlcNAc transferase (OGT) Substrate, Sequence: KKKYPGGSTPVSSANMM, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 1783.1, Apperance: powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-532

Supplier: Anaspec Inc

Sale

Description: HATPPKKKRK, Purity: HPLC >/- 95%, Molecular Weight: 1190.5, Sequence: H-His-Ala-Thr-Pro-Pro-Lys-Lys-Lys-Arg-Lys-OH, The native peptide, is a substrate for cyclin-dependent protein kinase 1, used to develop assays for CDK1, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103003-204

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 MMP-1 Assay Kit *Fluorimetric*, Components: MMP-1 substrate 60 ul, 5-FAM-Pro-Leu-OH 1 mM, 10 ul, APMA 1 M, 20 ul, Assay buffer 20 mL, Stop solution 10 mL, with Convenient Format, Optimized Performance, Enhanced Value, High Speed, Assured Reliability

Catalog Number: 103010-230

Supplier: Anaspec Inc

Sale

Description: Bovine;Human;Mouse;Rat Orexin A

Catalog Number: 103003-738

Supplier: Anaspec Inc

Sale

Description: HiLyte™ Fluor 488 hydrazide fluorescent dye

Catalog Number: 103010-880

Supplier: Anaspec Inc

Sale

Description: Sulforhodamine 101 C2 maleimide

Catalog Number: 103011-014

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Generic MMP Assay Kit Colorimetric, Components: MMP colorimetric substrate 10 mM, 100 uL, Reference standard 10 mM, 10 uL, Assay Buffer 20 mL, MMP inhibitor 2 mM, 10 uL, Trypsin 1 mg/mL, 100 uL,Trypsin inhibitor 10 mg/mL, 100 uL, Stop Solution 5 mL

Catalog Number: 103010-412

Supplier: Anaspec Inc

Sale

Description: HCV Protease FRET Substrate (RET S1), Purity: HPLC >/= to 95%, Molecular Weight: 1548.6, Sequence: Ac-DE-D(Edans)-EE-Abu-psi-[COO]-AS-K(Dabcyl)-NH2, Appearance: Lyophilized white powder, is a HCV protease substrate, Storage: -20 deg C, Size: 100 mg

Catalog Number: 102996-362

Supplier: Anaspec Inc

Sale

Description: Protein A, recombinant, Purity: >95% by SDS-PAGE, Formulation: Sterile salt-free liquid at 25mg/ml, Protein A is a non-glycosylated cell wall protein of Staphylococcus aureus that can bind the Fc part of immunoglobulin molecule of different species size: 5 mg

Catalog Number: 103010-688

Supplier: Anaspec Inc

Sale

Description: HIV Beclin-1 Peptide

Catalog Number: 103009-978

Supplier: Anaspec Inc

Sale