You Searched For: Hytest Ltd

Description: Beta-Amyloid (1-12), Human, Sequence: DAEFRHDSGYEV, Purity: By HPLC greater than or equal to 95%, This is amino acids 1 to 12 fragment of the beta-amyloid peptide, Molecular Weight: 1424.5, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-584

Supplier: Anaspec Inc

Sale

Description: Deltorphin B, Sequence: YaFEVVG-NH2, Purity: By HPLC greater than or equal to 95%, Deltorphin B (or Deltorphin II) was first isolated from the skin of Phyllomedusa bicolor, Molecular Weight: 782.9, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-480

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (2-16)-Lys(Biotin-LC)-NH2, Human, Purity: HPLC >/= 95%, Molecular Weight: 2288.6, Sequence: H-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Lys-NH2This C-terminal biotinylated A beta contains a 6-carbon long chain, Size: 0.5mg

Catalog Number: 102996-324

Supplier: Anaspec Inc

Sale

Description: RH414, Synonym: N-(3-Triethylammoniumpropyl)-4-(4-(4-(diethylamino)phenyl)butadienyl) pyridinium dibromide, Widely used for functional imaging of neurons, Molecular Weight: 581.5, Spectral Properties: Abs/Em = 532/716 nm, MF: C28H43Br2N3, Form: Solid, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103011-256

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 Deubiquitination Assay Kit *Fluorimetric*, Components: 520 DUB fluorogenic substrate 2 mM, 50 ul, Fluorescence standard 2 mM, 10 ul, Deubiquitin protease 0.5 mg/mL, 20 ul, 2X Assay Buffer 25 mL, DTT 1 M, 100 ul, UCH-L3 Inhibitor 4 mM, 10 ul

Catalog Number: 103010-614

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (1 - 40), Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4329.9, post-secretory aggregation and deposition in the Alzheimer’s disease brain, Size: 0.5 mg

Catalog Number: 102999-790

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Anti-PLP (178-191) IgG Quantitative ELISA Kit (Mouse) Colorimetric, determine anti-PLP (178-191) IgG antibody, Wells are pre-coated with PLP peptide and pre-blocked with BSA, Storage: At 2-8 degree C, Size: One 96-well strip plate

Catalog Number: 103001-340

Supplier: Anaspec Inc

Sale

Description: 520 MMP FRET Substrate VII, Purity: HPLC >/- 95%, Molecular Weight: 1963.1, Sequence: QXL* 520-Pro-Leu-Gly-Met-Trp-Ser-Arg-Lys(5-FAM)-NH2, A sensitive substrate for assaying MMP-2 and 13 activities, Abs/Em = 494/521 nm, Storage: -20 deg C, size: 0.1 mg

Catalog Number: 103003-250

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)14]-Histone H3 (9-19), H3K14(Ac), Sequence: KSTGG-K(Ac)-APRKQ, Purity: By HPLC greater than or equal to 95%, H3 peptide acetylated at the lysine residue at the 14th position, Molecular Weight: 1199.4, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-656

Supplier: Anaspec Inc

Sale

Description: Gastrin-1, rat, Purity: HPLC >/= 95%, Molecular Weight: 2126.3, Sequence: Pyr-Arg-Pro-Pro-Met-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2, Appearance: Powder, Storage: -20 deg C, Size: 1mg

Catalog Number: 102996-112

Supplier: Anaspec Inc

Sale

Description: Omega - Conotoxin GVIA, Sequence: CKS(Hyp)GSSCS(Hyp)TSYNCCRSCN(Hyp)YTKRCY - NH2, Purity: HPLC greater than or equal to 95%, neurotoxin that blocks N-type calcium channels, Molecular Weight: 3037.4, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102999-382

Supplier: Anaspec Inc

Sale

Description: LCMV NP396 H-2Db peptide rat insulin promoter Lymphocytic Choriomeningitis Virus-Nucleoprotein fragment amino acid residues 396 to 404, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): FQPQNGQFI, MW: 1078.2, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-908

Supplier: Anaspec Inc

Sale

Description: Protease-Activated Receptor-1, PAR-1 Agonist, amide MW: 883, Sequence: AF(para-Fluoro)R-Cha-Cit-Y-NH2] This peptide is PAR-1 selective agonist displaying a high level of specificity to PAR-1 over PAR-2. Store: -20 deg C, Size: 1mg

Catalog Number: 103010-002

Supplier: Anaspec Inc

Sale

Description: [Arg8]-Vasopressin (AVP), Purity: HPLC >/= 95%, Molecular Weight: 1084.3, Sequence: H-Cys-Tyr-Phe-Gln-Asn-Cys-Pro-Arg-Gly-NH2, identified as an important regulator of fluid and electrolyte homeostasis through its anti-diuretic action on the kidney, Size: 1 mg

Catalog Number: 102996-516

Supplier: Anaspec Inc

Sale

Description: [Lys(Me1)27]-Histone H3 (21-44)-GK(Biotin), H3K27(Me1), biotin-labeled, Sequence: ATKAAR-K(Me1)-SAPATGGVKKPHRYRPG-GK(Biotin), Purity: By HPLC >/= 95%, Histone H3 amino acid residues 21 to 44 mono-methylated, Molecular Weight: 2931.5, Size: 0.25 mg

Catalog Number: 103008-000

Supplier: Anaspec Inc

Sale

Description: [Lys(Me1)18]-Histone H3 (1-21)-GGK(Biotin), H3K18(Me1), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2736.2, Sequence: ARTKQTARKSTGGKAPR-K(Me1)-QLA-GGK(Biotin)-NH2, Label: Biotin, 0, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-326

Supplier: Anaspec Inc

Sale