You Searched For: Hytest Ltd

Description: OVA (323-339), Purity: Greater than or equal to 95% (HPLC), Formula: C84H134N28O27S1, Molecular weight: 2000.2, Sequence: Biotin-ISQAVHAAHAEINEAGR, Label: Biotin, Appearance: Powder, N-terminal OVA Peptide, amino acids 323 to 339, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-440

Supplier: Anaspec Inc

Sale

Description: 6-FAM, isomer of carboxyfluorescein, Synonym: 6-Carboxyfluorescein, Molecular Weight: 376.32, Molecular Formula: C21H12O7, Appearance: Red solid, Purity: >95 % (TLC), Spectral Properties: Abs/Em = 495/517 nm, Solvent System: DMF or DMSO, Storage: -20 deg C desiccated, Size: 100 mg

Catalog Number: 103010-760

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (25-35), Human, mouse/rat, Purity: HPLC >/= 95%, Molecular Weight: 1060.3, Sequence: H-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-OH, is the main factor responsible for AB neurotoxic effects, Storage: -20 deg C, Size: 5 mg

Catalog Number: 102996-478

Supplier: Anaspec Inc

Sale

Description: Histone H4 (1-7), N-Terminal, Sequence: SGRGKGG, Purity: By HPLC greater than or equal to 95%, This is amino acids 1 to 7 fragment of the histone H3, Molecular Weight: 617.7, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-508

Supplier: Anaspec Inc

Sale

Description: Aminopeptidase N Ligand (CD13), NGR peptide, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 606.7, Sequence: (One-Letter Code) CNGRCG (Disulfide bridge: 1-5), Appearance: White Powder, Storage: At -20 Degree C, Size: 5mg

Catalog Number: 103002-742

Supplier: Anaspec Inc

Sale

Description: CSP-1, Competence Stimulating Peptide-1, Sequence: EMRLSKFFRDFILQRKK, Purity: By HPLC greater than or equal to 95%, Competence stimulating peptide-1 is a 17 amino acids pheromone, Molecular Weight: 2242.7, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-722

Supplier: Anaspec Inc

Sale

Description: Apelin - 12 Peptide, Purity: greater than or equal to 95% by HPLC, These peptides lowers blood pressure via a nitric oxide-dependent mechanism and involved in the central control of feeding by stimulating cholecystokinin (CCK) secretion, Storage: -20 deg C, Size: 1mg

Catalog Number: 102971-776

Supplier: Anaspec Inc

Sale

Description: Protein A - HiLyte* Fluor 488 Conjugate, Purity: >95% SDS-PAGE, Fluorescence: Green Fluorescence, Excitation/Emission wavelength= 499 nm/523 nm, Applications: to detect primary antibodies in IHC from many species rabbit, human, size: 1 mg

Catalog Number: 103010-692

Supplier: Anaspec Inc

Sale

Description: Vasoactive Intestinal Peptide, human, porcine, rat, Purity: HPLC >/= to 95%, Molecular Weight: 3684.2, Sequence: FAM-HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, label: FAM, This is a fluorescent (FAM)-labeled VIP, Abs/Em=492/518 nm, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-398

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (1 - 43), Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT, Purity: HPLC >/- 95%, Molecular Weight: 4615.2, Solid AB (1-43) fibril is the most fibrillogenic of all the AB peptides, Apperance: Powder, Storage: -20 C, Size: 0.5 mg

Catalog Number: 102999-852

Supplier: Anaspec Inc

Sale

Description: Tau Peptide (275-305) (Repeat 2 domain), Purity: HPLC >/= 95%, Molecular weight: 3263.77, Sequence: VQIINKKLDLSNVQSKCGSKDNIKHVPGGGS] TAU proteins belong to the microtubule-associated protein (MAP) family, Store: -20 deg C, Size: 1mg

Catalog Number: 103009-738

Supplier: Anaspec Inc

Sale

Description: FITC-LC-Antennapedia Peptide, Purity: HPLC >/= to 95%, Molecular Weight: 2748.3, Sequence: FITC-LC-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-NH2, This is a fluorescent (FITC)-labeled Antennapedia, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-460

Supplier: Anaspec Inc

Sale

Description: Fibrinolysis Inhibiting Factor, Sequence: GPRP, Purity: HPLC greater than or equal to 95%, Molecular Weight: 425.5, Apperance: Lyophilized white powder, Peptide Reconstitution: Fibrinolysis peptide is freely soluble in water, Storage: -20 deg C, Size: 5 mg

Catalog Number: 102999-798

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-16), Human, Purity: HPLC >/- 95%, Molecular Weight: 1955, Sequence: H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-OH, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103003-704

Supplier: Anaspec Inc

Sale

Description: AnaTag* Biotin Protein Labeling Kit, components: Biotin, SE 3 vials, Reaction buffer 1 Ml, Desalting column 3 Pre-packed columns, DMSO 1 ml, 10X Elution buffer 30 ml, One conjugation reaction can label up to 10 mg protein, storage: 4 deg C

Catalog Number: 103010-370

Supplier: Anaspec Inc

Sale

Description: Kinase Substrates Library, Group II, biotinylated, 18 distinct peptide mixtures, Storage: -20 deg C, Size: 1 Set

Catalog Number: 103007-292

Supplier: Anaspec Inc

Sale