You Searched For: Inorganic+Halides

Description: West Nile Virus NS3 Protease, recombinant, Concentration: 100 ug/ml, is a member of the flavivirus genus, which contains many significant human pathogens including Dengue virus, positive sense 11kb RNA genome, Storage: -80 deg C, size: 100 ug

Catalog Number: 103010-402

Supplier: Anaspec Inc

Sale

Description: Glucagon-Like Peptide 1, GLP-1 (7-37), Purity: HPLC >/= to 95%, Molecular Weight: 3355.7, Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG, is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-116

Supplier: Anaspec Inc

Sale

Description: [Lys(Me2)27]-Histone H3 (23-34), H3K27(Me2), Sequence: KAAR-K(Me2)-SAPATGG, Purity: By HPLC >/= 95%, peptide is Histone H3 amino acid residues 23 to 34 di-methylated at Lys-27, Molecular Weight: 1142.3, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103008-032

Supplier: Anaspec Inc

Sale

Description: 5(6)-Carboxyfluorescein

Catalog Number: 103010-746

Supplier: Anaspec Inc

Sale

Description: Erythropoietin-Mimetic Peptide 17 (EMP17), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1981.3, Sequence: TYSCHFGPLTWVCKPQGG, EMP17 is the hormone involved in red blood cell production, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-150

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)12/16]-Histone H4(1-25)-GSGSK(Biotin); H4K12/16(Ac), Purity: Greater than or equal to 95%(HPLC), Molecular weight: 3316.8, Sequence: SGRGKGGKGLG-K(Ac)-GGA-K(Ac)-RHRKVLRDNGSGS-K(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103009-070

Supplier: Anaspec Inc

Sale

Description: Human Recombinant MOG (1-125) (from <i>E. coli</i>)

Catalog Number: 102998-096

Supplier: Anaspec Inc

Sale

Description: HCV Protease Substrate, DABCYL-EDANS

Catalog Number: 102996-360

Supplier: Anaspec Inc

Sale

Description: LL-37, Antimicrobial Peptide, human Antimicrobial peptide belonging  to the cathelicidin family, amphipathic alpha-helical peptide, Purity: HPLC >/=95%, Sequence (1-Letter Code): [LL-37, 37 aa], MW: 4493.3, Storage: -20deg C, Size: 1mg

Catalog Number: 103006-556

Supplier: Anaspec Inc

Sale

Description: RYR2 (2460-2495), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 4103.9, Sequence: GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP, amino acids 2460 to 2495 fragment of cardiac ryanodine receptor (RyR2), controls calcium release, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-442

Supplier: Anaspec Inc

Sale

Description: Histone H2B (21-41), biotin-labeled, Sequence: AQKKDGKKRKRSRKESYSIYVGG-K(Biotin), Purity: By HPLC >/= 95%, Histone 2B amino acid residues 21 to 41 with a C-terminal GG linker followed by a biotinylated lysine, Molecular Weight: 3024.6, Storage: -20 C, Size: 1 mg

Catalog Number: 103008-048

Supplier: Anaspec Inc

Sale

Description: 5 - FITC Microscale Protein Labeling Kit AnaTag™ 'Ultra Convenient'

Catalog Number: 103010-376

Supplier: Anaspec Inc

Sale

Description: SensoLyte* FDP Alkaline Phosphatase Assay Kit *Fluorimetric*, Components: FDP, 1 vial, 2X Assay buffer 30 mL, Stop solution 30 mL, 10X Lysis buffer 50 mL, Triton X-100 500 ul, 500 ul, Alkaline Phosphatase Standard Calf Intestine 10 u
g/mL, 50 ul

Catalog Number: 103010-122

Supplier: Anaspec Inc

Sale

Description: Recombinant Human Tau (Tau-441) Protein, GST tagged at the N-terminal, Microtubule associated protein, Source: E. Coli, Purity: Greater than 90% as determined by SDS-PAGE, 71.8 kDa, Application: In vitro phosphorylation, Storage: 2-4 degree C, Size: 100ug

Catalog Number: 103001-724

Supplier: Anaspec Inc

Sale

Description: EndoFree Recombinant Human alpha-Synuclein Protein, Source: E. Coli, Purity: Greater than 90% as determined by SDS-PAGE, Thioflavin T assay, Application: Fibrillation, oligomerization, cell toxicity studies, Storage: 2-4 degree C, Size: 100ug

Catalog Number: 103001-642

Supplier: Anaspec Inc

Sale

Description: [Ser25]-PKC (19-31), biotinylated, Purity: HPLC >/= 95%, Molecular Weight: 1914.3, Sequence: Lys(Biotin)-Arg-Phe-Ala-Arg-Lys-Gly-Ser-Leu-Arg-Gln-Lys-Asn-Val-OH, Appearance: Lyophilized white powder, derived from the pseudosubstrate regulatory domain, Size: 1 mg

Catalog Number: 102996-368

Supplier: Anaspec Inc

Sale