You Searched For: Hytest Ltd

Description: AnaTag* R-PE Labeling Kit, This kit is optimized for conjugating R-phycoerythrin to antibody, It provides ample materials to perform one conjugation reaction, One conjugation reaction can label up to 1 mg antibody, also provides the advantage of multi-color cell sorting

Catalog Number: 103010-184

Supplier: Anaspec Inc

Sale

Description: Oxytocin, Purity: HPLC >/= to 95%, Molecular Weight: 1007.2, Sequence: H-Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly-NH2, is a 9-amino acid peptide that is synthesized primarily in the hypothalamic neurons, specifically the magnocellular oxytocin neurons, Storage: -20 deg C, Size: 5 mg

Catalog Number: 102996-496

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (5-42), Human, Purity: Greater than or equal to 95%( % Peak Area By HPLC), Molecular weight: 4051.6, Sequence: RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA (One-Letter Code), Storage: At -20 Degree C, Size: 0.1mg

Catalog Number: 103002-974

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 490 MMP-13 Assay Kit *Fluorimetric*, Components: MMP-9 substrate 270 ul, EDANS 1 mM DMSO solution, 10 ul, APMA 1 M, 100 ul, Assay buffer 60 mL, Stop solution 30 mL, with Convenient Format, Optimized Performance, Enhanced Value, High Speed

Catalog Number: 103010-162

Supplier: Anaspec Inc

Sale

Description: Phytochelatin 2, PC2, Purity: HPLC >/- 95%, Molecular Weight: 540.6, Sequence: H-Y-Glu-Cys-Y-Glu-Cys-Gly-OH, A glutathione-derived heavy metal-detoxifying peptide of higher plants consisting of 2 units of YGlu-Cys, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103003-386

Supplier: Anaspec Inc

Sale

Description: HIV Beclin-1 Peptide

Catalog Number: 103009-976

Supplier: Anaspec Inc

Sale

Description: 5-FAM cadaverine

Catalog Number: 103011-020

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 Aggrecanase-1 Assay Kit *Fluorimetric*, Components: 5-FAM/5-TAMRA 60 ul, 5-FAM 1mM, 10 ul, Assay Buffer 20 Ml, Control Inhibitor 100 u
M, 10 ul, Stop Solution 10 mL, with Convenient Format, Enhanced Value, High Speed, storage: -20 deg C

Catalog Number: 103010-186

Supplier: Anaspec Inc

Sale

Description: Renin 390 FRET Substrate I peptide is a renin substrate (angiotensinogen) labeled with EDANS/ DABCYL FRET pair for renin activity studies, Purity: HPLC>/=95%, Sequence (One-Letter Code): R-E(EDANS)-IHPFHLVIHT-K(DABCYL)-R, Molecular weight: 2282.7, Size: 1 mg

Catalog Number: 103006-940

Supplier: Anaspec Inc

Sale

Description: Endothelin 1, human, porcine, sequence: CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11), Purity: HPLC greater than or equal to 95%, Molecular Weight: 2492, potent vasoconstrictor peptide derived from endothelial cells, Storage: -20 C, Size: 0.5 mg

Catalog Number: 102999-370

Supplier: Anaspec Inc

Sale

Description: AnaTag* 5 - FITC Protein Labeling Kit *Ultra Convenient* Components: 5-FITC 3 vials, Reaction buffer: 0.5 mL, Desalting column 3 Pre-packed columns, DMSO 1 Ml, 10X Elution buffer 30 mL, One conjugation reaction can label up to 5 mg protein

Catalog Number: 103010-374

Supplier: Anaspec Inc

Sale

Description: Adrenomedullin (1-52), human, Purity: HPLC >/- 95%, Molecular Weight: 6028.8, Sequence: YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2, Appearance: Lyophilized white powder, is a 52-amino acid peptide initially isolated from pheochromyctoma, Size: 0.5 mg

Catalog Number: 103003-154

Supplier: Anaspec Inc

Sale

Description: NBD-X, Synonym: 6-(N-(7-Nitrobenz-2-oxa-1,3-diazol-4-yl)amino)hexanoic acid, building block that can be used to prepare peptide conjugates and other bioconjugate, Molecular Weight: 294.27, Spectral Properties: Abs/Em = 467/539 nm, Solvent System: DMSO, Size: 100mg

Catalog Number: 103010-902

Supplier: Anaspec Inc

Sale

Description: Calcitonin Gene Related Peptide, CGRP (8 - 37), human, Sequence: VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF - NH2, CGRP receptor antagonist, Purity: HPLC greater than or equal to 95%, Molecular Weight: 3125.6, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102999-366

Supplier: Anaspec Inc

Sale

Description: Influenza A NP(366-374) Strain A/PR/8/35, Purity: HPLC >/- 95%, Molecular Weight: 1027.1, Sequence: H-Ala-Ser-Asn-Glu-Asn-Met-Glu-Thr-Met-OH, This peptide is an H2-Db-restricted epitope from the Influenza A/PR/8/34 nucleoprotein, Size: 1 mg

Catalog Number: 103003-278

Supplier: Anaspec Inc

Sale

Description: 5(6) - TAMRA, Special Formulation, Synonym: 5-(and-6)-Carboxytetramethylrhodamine, Molecular Weight: 430.45 (Free Acid), Spectral Properties: Abs/Em = 541/565 nm, Solvent System: DMF or DMSO, Physical State: Solid, Storage: -20 deg C, Size: 1 g

Catalog Number: 103010-830

Supplier: Anaspec Inc

Sale