You Searched For: Hytest Ltd

Description: Temporin A, amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1396.8, Sequence: FLPLIGRVLSGIL-NH2, Appearance: Solid, highly hydrophobic antimicrobial peptide amide derived from the frog Rana temporaria (inducing the migration), Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-474

Supplier: Anaspec Inc

Sale

Description: Plasmodium falciparum Plasmodium falciparum Circumsporozoite Protein, (6NANP) PfCSP, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2499.6, Sequence: NANPNANPNANPNANPNANPNANPC, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-084

Supplier: Anaspec Inc

Sale

Description: Lactoferricin B, Lactoferrin (17-41), Sequence: FKCRRWQWRMKKLGAPSITCVRRAF (S-S BOND), Purity: By HPLC >/= 95%, This is amino acids 17 to 41 fragment of lactoferrin, known as lactoferricin B, Molecular Weight: 3123.9, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-460

Supplier: Anaspec Inc

Sale

Description: SensoLyte* FDG B-Galactosidase Assay Kit *Fluorimetric*, Components: B-galactosidase substrate 10 mM, 250 uL, Fluorescein 2 mM, 25 uL, B-galactosidase enzyme 0.1 mg/mL, 20 uL, Assay buffer 100 mL, DTT 1 M, 4.5 mL, Triton X-100 200 uL, Stop solution 30 mL

Catalog Number: 103010-472

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Rh110 Factor Xa Assay Kit *Fluorimetric*, Components: Rh110 Factor Xa substrate 0.4 mM, 50 uL, Rh110 0.4 mM, 10 uL, Purified Bovine Factor Xa 5 ng/uL, 20 uL, 2X Assay Buffer 25 Ml, Factor Xa Inhibitor 1 mM, 20 uL, storage: -20 deg C

Catalog Number: 103010-622

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-39), Purity: HPLC >/= 95%, Molecular Weight: 4230.7, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV, Appearance: Lyophilized white powder, identified as the major components of the cerebral amyloid deposits in Alzheimer’s disease, Size: 1 mg

Catalog Number: 102996-522

Supplier: Anaspec Inc

Sale

Description: VIP, human, porcine, rat, Purity: HPLC >/= to 95%, Molecular Weight: 3325.9, Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, Appearance: Lyophilized white powder, is a neurotransmitter and a neuromodulator, broadly distributed in the peripheral and central nervous systems, Size: 1 mg

Catalog Number: 102996-316

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 647 C2 maleimide, thiol-reactive fluorescent labeling dye, Molecular Weight: 1196.46, Spectral Properties: Abs/Em = 649/674 nm, Solvent System: water or DMF, used to generate protein conjugates, Physical State: Solid, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103010-798

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 490 MMP-12 Assay Kit *Fluorimetric*, Components: MMP-12 substrate 270 ul, EDANS 1 mM, 10 ul, APMA 1 M, 100 ul, Assay buffer 60 mL, Stop solution 30 mL, with Convenient Format, Optimized Performance, Enhanced Value, High Speed, storage: -20 deg C

Catalog Number: 103010-166

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 390 Cathepsin D Assay Kit *Fluorimetric*, Components: Mca/Dnp, Cathepsin D substrate, 1.6 mM, 50 uL, Mca fluorescence reference standard 2 mM, 10 uL, Cathepsin D, 0.1 mg/mL, 20 uL, Assay Buffer 20 mL, Pepstatin A 4 mM, 100 uL, DTT 1 M, 100 uL

Catalog Number: 103010-418

Supplier: Anaspec Inc

Sale

Description: Human Platelet Factor IV 18, C18G, Sequence: ALYKKLLKKLLKSAKKLG, Purity: By HPLC greater than or equal to 95%, C18G is a synthetic A-helical peptide derived from human platelet factor IV, Molecular Weight: 2043.7, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-328

Supplier: Anaspec Inc

Sale

Description: Human MMP-1 (Recombinant, Catalytic Domain), Matrix metalloproteinases, Source: E. Coli, Purity: Greater than 95% as determined by SDS-PAGE, corresponding to the catalytic domain (aa 106-261), 17.5 kDa, Storage: -80 degree C, Size: 1ug

Catalog Number: 103001-682

Supplier: Anaspec Inc

Sale

Description: Parathyroid Hormone (1-34), human, Purity: HPLC >/= to 95%, Molecular Weight: 4117.8, Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVF, Appearance: Lyophilized white powder, regulates the metabolism of calcium and phosphate, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-094

Supplier: Anaspec Inc

Sale

Description: OVA (241-270), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 3421.9, Sequence: SMLVLLPDEVSGLEQLESIINFEKLTEWTS, peptide residues 241 to 270, a class I (Kb)-restricted peptide epitope of ovalbumin presented by the class I MHC, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-218

Supplier: Anaspec Inc

Sale

Description: CEF Control Peptide Pool, contains 0.03 mg (net) of the 32 CEF peptides, Used in the stimulation of IFNY release from CD8+ T cells in individuals, ELISPOT, intracellular cytokine and CTL assays, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-274

Supplier: Anaspec Inc

Sale

Description: MUC5AC-13 glycopeptide is an N-acetyl galactosamine (GalNAc)-modified MUC5AC mucin peptide containing the single site of threonine 13 labeled with GalNAc (T*), Purity: HPLC >/=95%, Sequence (One-Letter Code): GTTPSPVPTTST-T*-SAP, MW: 1704.6, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-582

Supplier: Anaspec Inc

Sale