You Searched For: Hytest Ltd

Description: EGFR Protein Tyrosine Kinase Substrate [ADEYLIPQQ], Purity: HPLC greater than or equal to 95%, Sequence (Three-Letter Code) H - Ala - Asp - Glu - Tyr - Leu - Ile - Pro - Gln - Gln - OH, Molecular Weight: 1076.1, Storage: -20degree C, Size: 1mg

Catalog Number: 102997-478

Supplier: Anaspec Inc

Sale

Description: [Lys8,9] - Neurotensin (8 - 13)H - Lys - Lys - Pro - Tyr - Ile - Leu - OH, Sequence:, Purity: HPLC greater than or equal to 95%, Molecular Weight: 761, Storage: -20 deg C, Size: 5 mg

Catalog Number: 102999-808

Supplier: Anaspec Inc

Sale

Description: Charybdotoxin, ChTX is a Ca2+-activated K+ channel blocker, t depolarizes peripheral T lymphocytes and blocks their mitogen-induced proliferation, Purity: Peak Area By HPLC >/= 95%, Appearance: Lyophilized white powder, MW: 4296.0, Storage: -20 deg C, Size: 0.1 mg

Catalog Number: 103004-134

Supplier: Anaspec Inc

Sale

Description: CSK tide, FAM labeled, Sequence: 5-FAM-KKKKEEIYFFFG-NH2, Purity: By HPLC greater than or equal to 95%, FAM labeled peptide substrate (Abs/Em = 494/521 nm), Molecular Weight: 1921.2, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-770

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Green Glutaminyl Cyclase Activity Assay *Fluorimetric*, provides a convenient, two-step homogeneous procedure for measuring enzyme activity from various sources using a green fluorescence substrate, Optimized Performance, Enhanced Value

Catalog Number: 103010-676

Supplier: Anaspec Inc

Sale

Description: Prosaptide TX14(A), Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 1579.7, Sequence: TaLIDNNATEEILY
, 14-mer prosaptide sequence is derived from active neurotrophic region in amino-terminal portion of the saposin C domain, Storage: At -20 degree C, Size: 1mg

Catalog Number: 103003-028

Supplier: Anaspec Inc

Sale

Description: Histone H4 (1-25)-GSGSK(Biotin), Purity: HPLC >/= 95%, Molecular weight: 3232.7, Sequence: [SGRGKGGKGLGKGGAKRHRKVLRDNGSGS-K(Biotin)], This is histone H4 (1-25) with a C-terminal GSGS linker, followed by a biotinylated lysine. Biotin - labeled, Store: -20 deg C, Size: 1mg

Catalog Number: 103009-192

Supplier: Anaspec Inc

Sale

Description: GIP (3-42), human, potent antagonist as opposed to the agonist full length GIP on the GIP receptor, Purity: HPLC >/= 95%, Sequence (One-Letter Code): EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ, MW: 4759.4, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 5 mg

Catalog Number: 103006-440

Supplier: Anaspec Inc

Sale

Description: H-D-Val-Leu-Arg-AFC, Purity: HPLC >/= 95%, Molecular Weight: 597.5, Sequence: vLR-AFC, Appearance: Powder, This is a fluorescent glandular kallikrein substrate, Abs/Em=380/500 nm, Storage: -20 deg C, Size: 10 mg

Catalog Number: 102996-446

Supplier: Anaspec Inc

Sale

Description: Apamin, Purity: By HPLC >/= 95%, MW: 2027.4, Sequence: (One-Letter Code): CNCKAPETALCARRCQQH-NH2 (Disulfide bridge: 1-11, 3-15) An 18-amino acid peptide from bee venom, a selective blocker of calcium activated potassium channels, Physical State: White Powder, Size: 0.5 mg

Catalog Number: 103005-972

Supplier: Anaspec Inc

Sale

Description: [Asn23]-beta-Amyloid (1-40), Iowa Mutation, Human, Sequence: DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV, Purity: HPLC >/= 95%, naturally occurring mutant within the beta-amyloid region of b-amyloid protein precursor, Molecular Weight: 4328.9, Size: 0.5 mg

Catalog Number: 103007-210

Supplier: Anaspec Inc

Sale

Description: Lys(Me2)4]-Histone H3 (1-21)-GGK(Biotin), H3K4(Me2), biotin-labeled, Purity: HPLC >/=95%, Sequence (One-Letter Code): ART-K(Me2)-QTARKSTGGKAPRKQLA-GGK(Biotin), Molecular weight: 2751.2, Storage: -20 degree C, Size: 0.25 mg

Catalog Number: 103006-532

Supplier: Anaspec Inc

Sale

Description: Cys - beta - Amyloid (1 - 42), Human, Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4617.3, Apperance: Powder, Storage: -20 deg C, Size: 0.1 mg

Catalog Number: 102999-618

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (1 - 40) - Lys(LC - biotin) - NH2, FAM - labeled, Human, FABB, Purity: By HPLC greater than or equal to 95%, biotinylated on the lysine side chain, Molecular Weight: 5154.9, Storage: -20 deg C, Size: 0.1 mg

Catalog Number: 103007-108

Supplier: Anaspec Inc

Sale

Description: Influenza NP (147 - 155) (TYQRTRALV), Sequence (Three-Letter Code): H - Thr - Tyr - Gln - Arg - Thr - Arg - Ala - Leu - Val - OH, Molecular Weight: 1107.3, Physical State: Powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-280

Supplier: Anaspec Inc

Sale

Description: Histone H2A (1-20)-GGK(Biotin), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2556, Sequence: SGRGKQGGKARAKAKTRSSRGG-K(Biotin), Label: Biotin, Histone H2A (1-20) with a C-terminal GG linker, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-484

Supplier: Anaspec Inc

Sale