You Searched For: Hytest Ltd

Description: Histone H3(1-35), Purity: HPLC >/= 95%, Molecular Weight: 3551.1, Sequence (One-Letter Code): [ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGV] This peptide is histone H3 (1-35). Store: -20 deg C, Size: 0.25mg

Catalog Number: 103009-474

Supplier: Anaspec Inc

Sale

Description: Indo-1, AM, Emission-ratiometric fluorescent indicator for quantifying intracellular Ca2+ concentration, Molecular Weight: 1009.9, Spectral Properties: Abs/Em = 346/475 nm, Solvent System: DMSO, Molecular Formula: C47H51N3O22C47H51N3O22, CAS number: 112926-02-0, Size: 1 mg

Catalog Number: 103011-166

Supplier: Anaspec Inc

Sale

Description: HATPPKKKRK, Purity: HPLC >/- 95%, Molecular Weight: 1190.5, Sequence: H-His-Ala-Thr-Pro-Pro-Lys-Lys-Lys-Arg-Lys-OH, The native peptide, is a substrate for cyclin-dependent protein kinase 1, used to develop assays for CDK1, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103003-204

Supplier: Anaspec Inc

Sale

Description: [Pro19]-beta-Amyloid (1-42); F19P beta - Amyloid (1 - 42), Human, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 4464.1, Sequence: DAEFRHDSGYEVHHQKLVPFAEDVGSNKGAIIGLMVGGVVIA, peptide is beta-amyloid (1-42), Storage: -20 degree C, Size: 1mg

Catalog Number: 103009-022

Supplier: Anaspec Inc

Sale

Description: C-Peptide-1, rat, Sequence: EVEDPQVPQLELGGGPEAGDLQTLALEVARQ, Purity: >/= 95%, amino acid sequence of rat C-peptide-1,C-peptide binds specifically to cell surfaces, probably to a G protein-coupled surface receptor, Molecular Weight: 3259.6, Storage: -20 C, Size: 0.5 mg

Catalog Number: 103007-680

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (1 - 40) - Lys(Biotin - LC), Human, Purity: HPLC >/- 95%, Molecular Weight: 4797.5, Appearance: Lyophilized white powder, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K, contains a 6-carbon long chain, size: 0.1 mg

Catalog Number: 103003-546

Supplier: Anaspec Inc

Sale

Description: DEAC, SE, Synonym: 7-Diethylaminocoumarin-3-carboxylic acid, succinimidyl ester, Purity: >/=95% by HPLC, blue fluorescent building block for labeling amine-containing biomolecules, MW: 358.35, Spectral Properties: Abs/Em = 432/472 nm, Solvent System DMF or Acetonitrile, Size: 25 mg

Catalog Number: 103010-900

Supplier: Anaspec Inc

Sale

Description: Protein A, recombinant, Purity: >95% by SDS-PAGE, Formulation: Sterile salt-free liquid at 25mg/ml, Protein A is a non-glycosylated cell wall protein of Staphylococcus aureus that can bind the Fc part of immunoglobulin molecule of different species size: 5 mg

Catalog Number: 103010-688

Supplier: Anaspec Inc

Sale

Description: Mastoparan, Sequence: INLKALAALAKKIL - NH2, Purity: HPLC greater than or equal to 95%, Molecular Weight: 1478.9, 14-residue peptide toxin from the wasp venom is originally found as a histamine releaser from mast cell, Apperance: Solid, Size: 5 mg

Catalog Number: 102999-800

Supplier: Anaspec Inc

Sale

Description: OVA (329-337), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 925, Sequence: AAHAEINEA; (Three-Letter Code) H - Ala - Ala - His - Ala - Glu - Ile - Asn - Glu - Ala - OH, sequence is OVA (ovalbumin) peptide residues 257 to 280, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-446

Supplier: Anaspec Inc

Sale

Description: Tyrosine Kinase Peptide 1 [KVEKIGEGTYGVVYK], Purity: HPLC >/- 95%, Molecular Weight: 1669.9, Sequence: H-Lys-Val-Glu-Lys-Ile-Gly-Glu-Gly-Thr-Tyr-Gly-Val-Val-Tyr-Lys-OH, Peptide sequence KVEKIGEGTYGVVYK is derived from the amino acid residues CDC26-20, Size: 5 mg

Catalog Number: 103003-222

Supplier: Anaspec Inc

Sale

Description: Histone H3 (69 - 89), H3K79, amide, Sequence: [RLVREIAQDFKTDLRFQSSAV-NH2] H3K69 methylation is generally associated with transcriptional activation, with methylation catalyzed by DOT/DOT1L enzyme in the context of a nucleosome. Store: -20 deg C, Size: 1mg

Catalog Number: 103009-700

Supplier: Anaspec Inc

Sale

Description: Uroguanylin (Rat) natriuretic peptide, a hormone that regulates sodium excretion by the kidney when excess NaCl is consumed, Purity: HPLC >/=95%, Sequence(1-Letter Code): TDECELCINVACTGC (Disulfide bond between Cys4-Cys12 and Cys7-Cys15), MW: 1569.8, Storage: -20C, Size: 1mg

Catalog Number: 103006-888

Supplier: Anaspec Inc

Sale

Description: LL-37, Antimicrobial Peptide, human Antimicrobial peptide belonging  to the cathelicidin family, amphipathic alpha-helical peptide, Purity: HPLC >/=95%, Sequence (1-Letter Code): [LL-37, 37 aa], MW: 4493.3, Storage: -20deg C, Size: 1mg

Catalog Number: 103006-556

Supplier: Anaspec Inc

Sale

Description: Phytochelatin 6, PC6 glutathione-derived heavy metal-detoxifying peptide of higher plants consisting of 6 units of YGlu-Cys, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): (YE-C)6-G, Molecular Weight: 1468.6, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-400

Supplier: Anaspec Inc

Sale

Description: Tetramethylrhodamine - 5 - maleimide, frequently used reagents for thiol modifications of peptides and proteins, MW: 481.51, Spectral Properties: Abs/Em = 540/567 nm, Solvent System: DMF or DMSO, Form: Dark violet solid, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103011-012

Supplier: Anaspec Inc

Sale