You Searched For: Hytest Ltd

Description: SensoLyte* 490 HIV Protease Assay Kit *Fluorimetric*, Components: HIV-1 protease substrate 600 ul, EDANS 100 u
M DMSO solution, 20 ul, Pepstatin A 27.4 u
g powder, 2X Assay buffer 50 mL, Stop solution 30mL, DMSO 100 ul, DMSO 100 ul, storage: -20 deg C

Catalog Number: 103010-148

Supplier: Anaspec Inc

Sale

Description: Cecropin A, Sequence: KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK - NH2, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4003.8, Apperance: Lyophilized white powder,Peptide Reconstitution: Cecropin A peptide is freely soluble in H2O, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102999-782

Supplier: Anaspec Inc

Sale

Description: ERKtide, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 1312.5, Sequence: (One-Letter Code) ATGPLSPGPFGRR, peptide substrate for ERK2. Extracellular regulated protein kinase 2 is a eukaryotic protein kinase, Appearance: white powder, Storage: At -20 degree C, Size: 5mg

Catalog Number: 103002-990

Supplier: Anaspec Inc

Sale

Description: MBP (84-97), Sequence: VVHFFKNIVTPRTP, Purity: By HPLC >/= 95%, amino acids 84 to 96 fragment of the myelin basic protein, peptide induces moderate experimental autoimmune encephalomyelitis (EAE) symptoms in immunized mice, Molecular Weight: 1655, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-492

Supplier: Anaspec Inc

Sale

Description: Rat Renin Inhibitor Peptide, WFML Peptide, Purity: HPLC >/- 95%, Molecular Weight: 957.3, Sequence: Ac-His-Pro-Phe-Val-Sta-Leu-Phe-NH2, A specific rat renin inhibitor, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103003-160

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 Thiol Quantitation Assay Kit *Fluorimetric*, Components: Thiol Detection Reagent 500 ul, Reduced Glutathione Standard Stock Solution 10 mM, 20 uL, Assay Buffer 50 mL, with Convenient Format, Enhanced Value, High Speed, storage: -20 deg C

Catalog Number: 103010-480

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (1 - 40). HCl, Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV. HCl, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4329.9.36.5, exert toxic effects on hippocampal cultured neurons, Size: 0.5 mg

Catalog Number: 102999-432

Supplier: Anaspec Inc

Sale

Description: Biotin - beta - Amyloid (1 - 40), Human, label: FAM, Purity: HPLC >/- 95%, Molecular Weight: 4556.2, Appearance: Lyophilized white powder, Sequence: FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, FAM is preferred over FITC, Storage -20 deg C, size: 0.5 mg

Catalog Number: 103003-540

Supplier: Anaspec Inc

Sale

Description: CEF1, Influenza Matrix Protein M1 (58 - 66), GILGFVFTL, HLA A2-restricted epitope, Sequence(Three-Letter Code): H - Gly - Ile - Leu - Gly - Phe - Val - Phe - Thr - Leu - OH, Molecular weight: 966.2, Physical State: Solid, Storage: -20deg C, Size: 1mg

Catalog Number: 102997-138

Supplier: Anaspec Inc

Sale

Description: RGDS, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 433.4, Sequence: RGDS; (Three-Letter Code) H - Arg - Gly - Asp - Ser - OH, short peptide RGDS (Arg-Gly-Asp-Ser) is a synthetic cell adhesion factor (activates caspases 8 and 9), Storage: -20 degree C, Size: 5mg

Catalog Number: 103008-184

Supplier: Anaspec Inc

Sale

Description: SensoLyte* ADHP Hydrogen Peroxide Assay Kit *Fluorimetric*, Components: ADHP 10 mM, 250 ul, H2O2 1 vial, Assay buffer 60 mL, H2O2 standard 1 vial, Assay buffer 60 mL, HRP, Horseradish peroxidase 5 vials, 100ul/vial, storage: -20 deg C

Catalog Number: 103010-130

Supplier: Anaspec Inc

Sale

Description: Calcein, AM, UltraPure Grade, CAS number: 148504-34-1, Purity: >/= 95% by HPLC, cell-permeant and non-fluorescent compound that is widely used for determining cell viability, MW: 994.9, Spectral Properties: Abs/Em = 494/517 nm, Solvent System: DMSO, Storage: -20 deg C, Size 1 mg

Catalog Number: 103011-398

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (25-35), HiLyte* Fluor 488-labeled, Human, mouse/rat, Sequence: HiLyte* Fluor 488-GSNKGAIIGLM, Purity: By HPLC >/= 95%, beta-amyloid peptide labeled, Molecular Weight: 1416.7, Storage: -20 C, Size: 0.1 mg

Catalog Number: 103007-596

Supplier: Anaspec Inc

Sale

Description: Gag Spacer Peptide P1, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1549.9, Sequence: HHHHHHIIKIIK, Appearance: Powder, peptide sequence is derived from the Gag spacer peptide p1 t(human immunodeficiency virus type 1), Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-444

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Thioflavin T B-Amyloid (1-40) Aggregation Kit, Components: Assay Buffer 25 ml, Beta-Amyloid (1-40) (AB40), human 0.5 mg (2 x 0.25 mg), Thioflavin T 20 mM, 100 ul, Morin 10 mM, 25 ul, Phenol Red 10 mM, 25 ul, storage: -20 deg C

Catalog Number: 103010-634

Supplier: Anaspec Inc

Sale

Description: Angiotensin II Substrate, Purity: HPLC >/- 95%, Molecular Weight: 1126.2, Sequence: H-Asp-Arg-Val-pTyr-Ile-His-Pro-Phe-OH, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103003-754

Supplier: Anaspec Inc

Sale