You Searched For: Hytest Ltd

Description: HiLyte* Fluor 555 acid, SE, Synonym: HiLyte* Fluor 555 acid, NHS ester, amine-reactive fluorescent labeling dye, Molecular Weight 1067.36, Spectral Properties: Abs/Em = 552/569 nm, Solvent System: DMF or DMSO, Physical State: Solid, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103010-934

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (16-22), Human, mouse/rat, Sequence: KLVFFAE, Purity: By HPLC greater than or equal to 95%, short fragment of the b-Amyloid peptide containing two aromatic phenylalanine residues, Molecular Weight: 853, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-544

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-16), Human, Purity: HPLC >/- 95%, Molecular Weight: 1955, Sequence: H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-OH, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103003-702

Supplier: Anaspec Inc

Sale

Description: LKBtide; LKB1/STK11 Substrate Peptide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2785.2, Sequence: LSNLYHQGKFLQTFCGSPLYRRR, peptide substrate that is phosphorylated by Serine/Threonine kinase 11 (STK11), Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-566

Supplier: Anaspec Inc

Sale

Description: MUC5AC 3 glycopeptide is a 16-amino acid modified fragment of mucin 5/MUC5AC, where T* is a GalNac labeled threonine 3, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): GT-T*-PSPVPTTSTTSAP, Molecular Weight: 1703.9, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-584

Supplier: Anaspec Inc

Sale

Description: Casein Kinase 2 (CK2) Substrate A-subunit, Purity: HPLC >/- 95%, Molecular Weight: 1264.2, Sequence: H-Arg-Arg-Arg-Asp-Asp-Asp-Ser-Asp-Asp-Asp-OH, Appearance: Powder, is unique among the protein kinases since it can use ATP as well as GTP, Size: 1 mg

Catalog Number: 103003-266

Supplier: Anaspec Inc

Sale

Description: Glucagon - Like Peptide 1, GLP - 1 amide, human, HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2, Peptide Purity: >95%, Molecular Weight: 4111.5, Appearance: Lyophilized white powder, Storage: –20 deg C or lower, Size: 0.5mg

Catalog Number: 102999-326

Supplier: Anaspec Inc

Sale

Description: Drosocin, Sequence: GKPRPYSPRPTSHPRPIRV, Purity: By HPLC >/= 95%, Drosocin is a 19-mer cationic antimicrobial peptide from Drosophila melanogaster, Molecular Weight: 2198.6, Apperance: Lyophilized white powder, Drosocin peptide is freely soluble in water, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-414

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 532 acid, SE, amine-reactive fluorescent labeling dye, with fluorescence excitation and emission maxima of Approx 545 nm and Approx 565 nm, MW: 875.36, Spectral Properties: Abs/Em = 545/565 nm, Solvent System: DMF or DMSO, Storage -20C, Size: 1 mg

Catalog Number: 103011-410

Supplier: Anaspec Inc

Sale

Description: D-(-)-Luciferin potassium salt ≥95% (by HPLC), Ultrapure

Catalog Number: 103011-096

Supplier: Anaspec Inc

Sale

Description: Human Biotin-Oxytocin, Biotin

Catalog Number: 102999-778

Supplier: Anaspec Inc

Sale

Description: 6-TAMRA special formulation

Catalog Number: 103010-840

Supplier: Anaspec Inc

Sale

Description: M13 Skeletal Muscle Myosin Light Chain Kinase Peptide

Catalog Number: 103002-830

Supplier: Anaspec Inc

Sale

Description: Influenza Matrix Protein (62-70)

Catalog Number: 103007-276

Supplier: Anaspec Inc

Sale

Description: Kemptide, FAM (Carboxyfluorescein)

Catalog Number: 102997-406

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Red Protease Assay Kit *Fluorimetric*, Components: Protease substrate 280 ul, Trypsin 5 U/ul, 100 ul, 2X Assay buffer 30 mL, with Convenient Format, Optimized Performance, Enhanced Value, High Speed, Assured Reliability, storage: -20 deg C

Catalog Number: 103010-168

Supplier: Anaspec Inc

Sale