You Searched For: Hytest Ltd

Description: TMRE, Synonym: Tetramethylrhodamine, ethyl ester, perchlorate, for measuring membrane potential of mitochondria; Fluorescence is less dependent on dye location, Molecular Weight: 514.96, Spectral Properties: Abs/Em = 549/574 nm, Solvent System: DMSO, CAS: 115532-52-0, Size: 25 mg

Catalog Number: 103011-368

Supplier: Anaspec Inc

Sale

Description: Biotin - LC - beta - Amyloid (1 - 40), Human, Purity: HPLC >/- 95%, Molecular Weight: 4669.3, Sequence: Biotin-LC-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, This biotinylated AB contains a 6-carbon long chain to provide more accesibility, size: 0.1 mg

Catalog Number: 103003-796

Supplier: Anaspec Inc

Sale

Description: [Lys(Me2)36]-Histone H3 (21-44)-GK(Biotin), H3K36(Me2), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2945.5, Sequence: ATKAARKSAPATGGV-K(Me2)-KPHRYRPG-GK(Biotin), Label: Biotin, Storage: -20 degree C, Size: 0.25mg

Catalog Number: 103008-166

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)14]-Histone H3 (1-21)-GGK(Biotin), H3K14(Ac), biotin-labeled, Sequence: ARTKQTARKSTGG-K(Ac)-APRKQLA-GGK(Biotin), Purity: >/= 95%, peptide is Histone H3 amino acid residues 1 to 21 acetylated, Molecular Weight: 2765.3, Size: 0.25 mg

Catalog Number: 103007-988

Supplier: Anaspec Inc

Sale

Description: C-Myc peptide epitope, Purity: HPLC >/- 95%, Molecular Weight: 1203.3, Sequence: H-Glu-Gln-Lys-Leu-Ile-Ser-Glu-Glu-Asp-Leu-OH, Appearance: Lyophilized white powder, This peptide is a human c-myc epitope, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103003-898

Supplier: Anaspec Inc

Sale

Description: LL17-32, Purity: HPLC >/= 95%, MW: 2045.5, Sequence: [FKRIVQRIKDFLRNLV] This peptide is an active segment of LL-37, a peptide derived from the C-terminal domain of human cathelicidin antimicrobial peptide. Appearance: Off white solid, Store: -20 deg C, Size: 5mg

Catalog Number: 103009-932

Supplier: Anaspec Inc

Sale

Description: AnaTag* HiLyte* Fluor 555 Protein Labeling Kit *Ultra Convenient*, HiLyte Fluor*555 SE 3 vials, Reaction buffer 0.5 mL, Desalting column 3 Pre-packed columns, DMSO 1 mL, 10X Elution buffer 30 mL, One conjugation reaction can label up to 5 mg protein

Catalog Number: 103010-350

Supplier: Anaspec Inc

Sale

Description: Calcitonin, human, Purity: % Peak Area By HPLC >/=95%, Molecular Weight: 3417.9, Sequence (One-Letter Code): CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7), Appearance: Lyophilized white powder, Peptide Reconstitution: freely soluble in water, Size: 1mg

Catalog Number: 102998-448

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (3-16), human, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1768.9, Sequence: EFRHDSGYEVHHQK, Appearance: Powder, peptide is amino acids 3 to 16 fragment of beta-Amyloid (AEszett) with an N-terminal deletion, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-452

Supplier: Anaspec Inc

Sale

Description: Influenza Virus Control Peptide Pool, peptides have been used in the stimulation of IFNY release from CD8+ T cells in individuals with defined HLA types, Storage: -20 deg C, Size: 3 mg

Catalog Number: 103007-298

Supplier: Anaspec Inc

Sale

Description: [Lys(Me1)4] - Histone H3 (1 - 21) - GGK(Biotin), H3K4(Me1), biotin - labeled, Purity: HPLC >/= 95%, Sequence(One-Letter Code): ART-K(Me1)-QTARKSTGGKAPRKQLA-GGK(Biotin), Molecular weight: 2737.2, Appearance: Off-white solid, Storage: -20 deg C, Size: 0.25 mg

Catalog Number: 103006-528

Supplier: Anaspec Inc

Sale

Description: [Arg(Me1)3]-Histone H4(1-21)-GGK(Biotin), H4R3(Me1), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2616.1, Sequence: Ac-SG-R(Me1)-GKGGKGLGKGGAKRHRKVGG-K(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-636

Supplier: Anaspec Inc

Sale

Description: AnaTag* HiLyte* Fluor 488 Protein Labeling Kit [3 labeling reactions (3 x 5 mg protein)], HiLyte Fluor*488 SE 3 vials, Reaction buffer 0.5 Ml, Desalting column 3 Pre-packed columns, DMSO 1 mL, 10X Elution buffer 30 ml, storage: 4 deg C

Catalog Number: 103010-354

Supplier: Anaspec Inc

Sale

Description: Histone H3 (15-36)-GGK(Biotin), Purity: HPLC >/= 95%, Sequence: [APRKQLATKAARKSAPATGGVKGG-K(biotin)] This peptide is Histone H3 amino acid residues 15-36 with a C-terminal GG linker followed by a biotinylated lysine. Store: -20 deg C, Size: 1mg

Catalog Number: 103009-532

Supplier: Anaspec Inc

Sale

Description: [Lys(Me3)20]-Histone H4 (1-23)-GGK(Biotin), H4K20(Me3), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2870.4, Sequence: SGRGKGGKGLGKGGAKRHR-K(Me3)-VLR-GGK(Biotin)-NH2, Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-342

Supplier: Anaspec Inc

Sale

Description: VSV - G Peptide, vesicular stomatitis virus G (VSV-G) protein fragment, Physical State: Powder, Molecular Weight 1339.5, Sequence (One-Letter Code) : TDIEMNRLGK, Sequence (Three-Letter Code) H - Tyr - Thr - Asp - Ile - Glu - Met - Asn - Arg - Leu - Gly - Lys - OH, Size: 1mg

Catalog Number: 102998-830

Supplier: Anaspec Inc

Sale