You Searched For: Hytest Ltd

Description: Histone H1-derived Peptide, phosphorylated by protein kinase A, substrate for CDK2 and CDK5 (cyclin dependent kinase 5) and PKA, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): GGGPATPKKAKKL, MW: 1252.5, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-968

Supplier: Anaspec Inc

Sale

Description: CKS-17 (dimer), MN10021, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 4088.8, Sequence: LQNRRGLDLLFLKEGGLC (dimer), dimer of CKS-17 has a natural occurring cysteine at the carboxyl terminus (cysteine-disulfide linkage), Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-252

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 MMP-12 Assay Kit *Fluorimetric*, Components: MMP-12 substrate 60 ul, 5-FAM-Pro-Leu-OH 1 mM, 10 ul, APMA 1 M, 20 ul, Assay buffer 20 mL, Stop solution 10 mL, with Convenient Format, Optimized Performance, Enhanced Value, High Speed, Assured Reliability

Catalog Number: 103010-244

Supplier: Anaspec Inc

Sale

Description: GRGDS, amide (GRGDS - NH2), Purity: HPLC greater than or equal to 95%, Sequence (Three-Letter Code: H - Gly - Arg - Gly - Asp - Ser - NH2, Molecular Weight: 489.5, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 5 mg

Catalog Number: 103006-346

Supplier: Anaspec Inc

Sale

Description: Rhodopsin Epitope Tag, Sequence: TETSQVAPA, Purity: HPLC greater than or equal to 95%, peptide representing C terminus of bovine rhodopsin widely used as an epitope tag, recognized by anti-rhodopsin antibodies, Molecular Weight: 903, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103007-234

Supplier: Anaspec Inc

Sale

Description: S6 Kinase Substrate (229 - 239), Purity: HPLC >/= 95%, Molecular Weight: 1313.6, Sequence: H-Ala-Lys-Arg-Arg-Arg-Leu-Ser-Ser-Leu-Arg-Ala-OH, Appearance: Lyophilized white powder, This is a synthetic peptide substrate for S6 kinase, Size: 5 mg

Catalog Number: 102996-886

Supplier: Anaspec Inc

Sale

Description: Bim BH3, Peptide IV, Sequence: DMRPEIWIAQELRRIGDEFNAYYARR, Bim peptide belongs to the pro-apoptotic group of the Bcl-2 family of proteins, Molecular Weight: 3269.7, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-272

Supplier: Anaspec Inc

Sale

Description: OVA (323-339), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2276.5, Sequence: FITC-LC-ISQAVHAAHAEINEAGR, Label: FITC-labeled, Appearance: White Powder, OVA (323 - 339) Peptide is an H-2b-restricted OVA class II epitope, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-438

Supplier: Anaspec Inc

Sale

Description: Galanin, human, Purity: HPLC >/- 95%, Molecular Weight: 3157.5, Sequence: GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS, Appearance: Lyophilized white powder, is found in the central and peripheral nervous systems and displays several important physiological activities, Size: 1 mg

Catalog Number: 103003-398

Supplier: Anaspec Inc

Sale

Description: DABCYL acid, SE, Synonym: 4-((4-(dimethylamino)phenyl)azo)benzoic acid, succinimidyl ester; DABCYL acid, NHS ester, acceptors for developing FRET-based nucleic acid probes, Purity: 95%, MW: 366.37, Spectral: Abs/Em = 453/none nm, Solvent System: DMF or DMSO, Size: 100 mg

Catalog Number: 103011-048

Supplier: Anaspec Inc

Sale

Description: Human BAD (103-127), FAM (Carboxyfluorescein)

Catalog Number: 103006-122

Supplier: Anaspec Inc

Sale

Description: Tetramethylrhodamine - 5 - maleimide, frequently used reagents for thiol modifications of peptides and proteins, MW: 481.51, Spectral Properties: Abs/Em = 540/567 nm, Solvent System: DMF or DMSO, Form: Dark violet solid, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103011-012

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 Thrombin Activity Assay Kit *Fluorimetric*, Components: Thrombin substrate 2 mM, 50 ul, 5-FAM 2 mM, 10 ul, 2X Assay buffer 20 mL, Purified human thrombin enzyme 0.1 mg/mL, 40 ul,Thrombin inhibitor 60 u
M, 10 ul, Stop solution 5 mL

Catalog Number: 103010-466

Supplier: Anaspec Inc

Sale

Description: Bacterial Sortase Substrate I

Catalog Number: 103007-254

Supplier: Anaspec Inc

Sale

Description: Hen Elafin

Catalog Number: 103006-886

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 MMP-3 Assay Kit * Fluorimetric*, Components: MMP-3 substrate 60 ul, 5-FAM-Pro-Leu-OH 1 mM, 10 ul, APMA 1 M, 20 ul, Assay buffer 20 mL, Stop solution 10 mL, with Convenient Format, Optimized Performance, Enhanced Value, High Speed, Assured Reliability

Catalog Number: 103010-234

Supplier: Anaspec Inc

Sale