You Searched For: +Ultra+Low+Temperature+Freezers


2,094  results were found

SearchResultCount:"2094"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103005-984)
Supplier: Anaspec Inc
Description: Caspase 1 Inhibitor II, Purity: % Peak Area By HPLC >/= 95%, Molecular Weight: 541, Sequence: (One-Letter Code): Ac-YVAD-CMK irreversible caspase-1, (IL-1B-converting enzyme, ICE) inhibitor, Physical State: White Powder, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103009-490)
Supplier: Anaspec Inc
Description: Thrombospondin-derived Peptide; Cyclic, Purity: HPLC >/= 95%, MW: 566.7, Sequence: CSVTCG [CSVTCG (S-S Bonded)] This peptide is derived from thrombospondin and represents a binding motif responsible for thrombospondin-CD36 interaction. Store: -20 deg C, Size: 1mg


Catalog Number: (103006-910)
Supplier: Anaspec Inc
Description: Histone H3 (1-21), N-Terminal, used as a substrate for methylation and acetylation assays, Purity: HPLC >/=95%, Sequence (One-Letter Code): ARTKQTARKSTGGKAPRKQLA, Molecular weight: 2254.6, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg


Catalog Number: (103006-080)
Supplier: Anaspec Inc
Description: LSKL, Inhibitor of Thrombospondin (TSP - 1) (LSKL - NH2), Purity: HPLC >/= 95%, Sequence (Three-Letter Code): H - Leu - Ser - Lys - Leu - NH2, Molecular Weight: 458.6, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103007-990)
Supplier: Anaspec Inc
Description: [Lys(Ac)14]-Histone H3 (1-21)-GGK(Biotin), H3K14(Ac), biotin-labeled, Sequence: ARTKQTARKSTGG-K(Ac)-APRKQLA-GGK(Biotin), Purity: >/= 95%, peptide is Histone H3 amino acid residues 1 to 21 acetylated, Molecular Weight: 2765.3, Size: 1 mg


Catalog Number: (103004-984)
Supplier: Anaspec Inc
Description: Alpha - Synuclein (1 - 140) Recombinant protein, Source: Human, Conjugate: HiLyte* Fluor 488, Purity: Greater than 95%(SDS-PAGE and mass spectrometry), Fluorescence: Green. Excitation/Emission wavelengths= 503 nm/525 nm, Size: 200 ug


Catalog Number: (103011-132)
Supplier: Anaspec Inc
Description: DAPI, Synonym: 4'',6 - Diamidino - 2 - phenylindole, dihydrochloride, AT-selective minor groove binder that exhibits nice fluorescence enhancement in the presence of DNA, MW: 350.3, Spectral Properties: Abs/Em = 358/461 nm, Solvent System: Water, Storage -20 deg C, Size: 10 mg


Catalog Number: (103007-660)
Supplier: Anaspec Inc
Description: [Lys(Ac)5]-Histone H4 (1-20), H4K5(Ac), Sequence: SGRG-K(Ac)-GGKGLGKGGAKRHRK, Purity: By HPLC greater than or equal to 95%, histone 4 peptide acetylated at lysine 5, Molecular Weight: 2034.4, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103010-172)
Supplier: Anaspec Inc
Description: SensoLyte* 520 B-Secretase Assay Kit *Fluorimetric*, Components: ?-secretase substrate 60 ul, HiLyte Fluor* 488 1 mM DMSO solution, 20 ul, ?-secretase Inhibitor 250 u
M, 10 ul, 2X Assay buffer 20 Ml, Stop Solution 10 mL, Human ?-secretase 0.5 mg/mL, 20 ul


Catalog Number: (103010-348)
Supplier: Anaspec Inc
Description: AnaTag* HiLyte* Fluor 750 Microscale Protein Labeling Kit *Ultra Convenient*, It provides ample materials to perform three protein conjugations and purifications, One conjugation reaction can label up to 200 ug proteins, storage: 4 deg C


Catalog Number: (103005-978)
Supplier: Anaspec Inc
Description: Protease - Activated Receptor - 4, PAR - 4 Agonist, amide, murine, Purity: By HPLC >/= 95%, MW: 666.8, Sequence: (One-Letter Code): GYPGKF-NH2, Physical State: White Powder, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103008-214)
Supplier: Anaspec Inc
Description: Prostatic Acid Phosphatase (248-286), PAP (248-286), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 4551.5, Sequence: GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY, Appearance: Powder, SEVI factor found in semen, Storage: -20 degree C, Size: 1mg


Catalog Number: (103009-058)
Supplier: Anaspec Inc
Description: [Lys(Ac)20]-Histone H4 (1-25)-GSGSK(Biotin); H4K20(Ac), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 3274.8, Sequence: SGRGKGGKGLGKGGAKRHR-K(Ac)-VLRDNGSGS-K(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg


Catalog Number: (103003-078)
Supplier: Anaspec Inc
Description: Biotin-Glucagon (1-29), bovine, human, porcine, Purity: HPLC >/- 95%, Molecular Weight: 3709.1, Sequence: Biotin-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT, Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells, Size: 1 mg


Catalog Number: (103008-230)
Supplier: Anaspec Inc
Description: [Lys(Me3)79]-Histone H3 (69-89)-K(Biotin), H3K79(Me3), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2876.3, Sequence: RLVREIAQDF-K(Me3)-TDLRFQSSAV-K(biotin), Label: Biotin, Storage: -20 degree C, Size: 0.25mg


Catalog Number: (103010-660)
Supplier: Anaspec Inc
Description: SensoLyte* 520 Cathepsin E Assay Kit *Fluorimetric*, Components: QXL* 520/HiLyte Fluor* 488 2 mM, 50uL, HiLyte Fluor* 488 2 mM, 10 uL, Human recombinant Cathepsin E 0.1 mg/mL, 10 uL, Assay Buffer 20 mL, Pepstatin A 10 uM, 20uL, storage: -20 deg C


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,953 - 1,968 of 2,094
no targeter for Bottom